General Information of This Antibody
Antibody ID
ANI0HRZCS
Antibody Name
AGS67C
Antibody Type
Monoclonal antibody (mAb)
Antibody Subtype
Humanized IgG2-kappa
Antigen Name
Leukocyte antigen CD37 (CD37)
 Antigen Info 
Click to Show/Hide the Sequence Information of This Antibody
Heavy Chain Sequence
QVQLQQWGAGLLKPSETLSLTCAVYGGSFSPYYWSWIRQPPGKGLEWIGEINHSGSTNYN
PSLKSRVTISVDTSKNQFSLKLSSVTAADTAVYYCARRAGDFDYWGQGTLVTVSSASTKG
PSVFPLAPCSRSTSESTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSL
SSVVTVPSSNFGTQTYTCNVDHKPSNTKVDKTVERKCCVECPPCPAPPVAGPSVFLFPPK
PKDTLMISRTPEVTCVVVDVSHEDPEVQFNWYVDGVEVHNAKTKPREEQFNSTFRVVSVL
TVVHQDWLNGKEYKCKVSNKGLPAPIEKTISKTKGQPREPQVYTLPPSREEMTKNQVSLT
CLVKGFYPSDIAVEWESNGQPENNYKTTPPMLDSDGSFFLYSKLTVDKSRWQQGNVFSCS
VMHEALHNHYTQKSLSLSPGK
    Click to Show/Hide
Light Chain Sequence
DIQMTQSPSTLSASVGDRVTITCRASQSISSWLAWYQQKPGKAPKLLIYKASSLESGVPS
RFSGSGSGTEFTLTISSLQPDDFATYYCQQYNSYIFGQGTKLEIKRTVAAPSVFIFPPSD
EQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLS
KADYEKHKVYACEVTHQGLSSPVTKSFNRGEC
    Click to Show/Hide
Each Antibody-drug Conjugate Related to This Antibody
Full Information of The Activity Data of The ADC(s) Related to This Antibody
AGS-67E [Phase 1]
Identified from the Human Clinical Data
Click To Hide/Show 2 Activity Data Related to This Level
Experiment 1 Reporting the Activity Date of This ADC [1]
Efficacy Data Objective Response Rate (ORR)
24.00% (0.9
1.2 and 1.5 mg/kg)
Low CD37 expression (CD37+; CD37 MFI ratio=82)
Patients Enrolled
Relapsed / refractory non Hodgkin lymphomas (NHLs) and chronic lymphocytic leukemia (CLL).
Administration Dosage
Administered intravenously (IV) once every 3 weeks (Q3 weeks) until disease progression or unacceptable toxicity.
Related Clinical Trial
NCT Number NCT02175433  Clinical Status Phase 1
Clinical Description
A phase 1 study evaluating safety, tolerability, and pharmacokinetics of escalating doses of AGS67E given as monotherapy in subjects with refractory or relapsed lymphoid malignancies.
Experiment 2 Reporting the Activity Date of This ADC [2]
Related Clinical Trial
NCT Number NCT02610062  Clinical Status Phase 1
Clinical Description
A phase 1 study evaluating safety, tolerability, and pharmacokinetics of escalating doses of AGS67E given as monotherapy in subjects with acute myeloid leukemia (AML).
Discovered Using Cell Line-derived Xenograft Model
Click To Hide/Show 22 Activity Data Related to This Level
Experiment 1 Reporting the Activity Date of This ADC [3]
Efficacy Data Tumor Growth Inhibition value (TGI)
0.00%
Low CD37 expression (CD37+; CD37 MFI ratio=82)
Method Description
The in vivo antitumor activity of AGS-67E was evaluated in a CD37 positive NHL,CLL and AmL cell line xenograft models. Depending on the cell line,110e6 cells were injected into the flanks of individual SCID mice,and tumor volumes were allowed to reach 100 to 300 mm3. Animals and their tumors were size matched and randomized into treatment and control groups. Depending on the study,AGS67E and an isotype control ADC were dosed by i.v. bolus injection either at 0.25,0.75,1.5,or 3.0 mg/kg at biweekly (BIW) or weekly (QW) frequencies and for a total of 2 to 4 doses.

   Click to Show/Hide
In Vivo Model CD37-expressing Hel 92.1.7 AmL cancer xenograft model
In Vitro Model Erythroleukemia HEL 92.1.7 cells CVCL_2481
Experiment 2 Reporting the Activity Date of This ADC [3]
Efficacy Data Tumor Growth Inhibition value (TGI)
27.00%
High CD37 expression (CD37+++; CD37 MFI ratio=580)
Method Description
The in vivo antitumor activity of AGS-67E was evaluated in a CD37 positive NHL,CLL and AmL cell line xenograft models. Depending on the cell line,110e6 cells were injected into the flanks of individual SCID mice,and tumor volumes were allowed to reach 100 to 300 mm3. Animals and their tumors were size matched and randomized into treatment and control groups. Depending on the study,AGS67E and an isotype control ADC were dosed by i.v. bolus injection either at 0.25,0.75,1.5,or 3.0 mg/kg at biweekly (BIW) or weekly (QW) frequencies and for a total of 2 to 4 doses.

   Click to Show/Hide
In Vivo Model CD37-expressing DOHH2 FL cancer xenograft model
In Vitro Model Diffuse large B-cell lymphoma germinal center B-cell type DoHH2 cells CVCL_1179
Experiment 3 Reporting the Activity Date of This ADC [3]
Efficacy Data Tumor Growth Inhibition value (TGI)
31.00%
High CD37 expression (CD37+++; CD37 MFI ratio=554)
Method Description
The in vivo antitumor activity of AGS-67E was evaluated in a CD37 positive NHL,CLL and AmL cell line xenograft models. Depending on the cell line,110e6 cells were injected into the flanks of individual SCID mice,and tumor volumes were allowed to reach 100 to 300 mm3. Animals and their tumors were size matched and randomized into treatment and control groups. Depending on the study,AGS67E and an isotype control ADC were dosed by i.v. bolus injection either at 0.25,0.75,1.5,or 3.0 mg/kg at biweekly (BIW) or weekly (QW) frequencies and for a total of 2 to 4 doses.

   Click to Show/Hide
In Vivo Model CD37-expressing WSU-DLCL2 DBCL cancer xenograft model
In Vitro Model Diffuse large B-cell lymphoma WSU-DLCL2 cells CVCL_1902
Experiment 4 Reporting the Activity Date of This ADC [3]
Efficacy Data Tumor Growth Inhibition value (TGI)
41.00%
Low CD37 expression (CD37+; CD37 MFI ratio=20)
Method Description
The in vivo antitumor activity of AGS-67E was evaluated in a CD37 positive NHL,CLL and AmL cell line xenograft models. Depending on the cell line,110e6 cells were injected into the flanks of individual SCID mice,and tumor volumes were allowed to reach 100 to 300 mm3. Animals and their tumors were size matched and randomized into treatment and control groups. Depending on the study,AGS67E and an isotype control ADC were dosed by i.v. bolus injection either at 0.25,0.75,1.5,or 3.0 mg/kg at biweekly (BIW) or weekly (QW) frequencies and for a total of 2 to 4 doses.

   Click to Show/Hide
In Vivo Model CD37-expressing KG-1 AmL cancer xenograft model
In Vitro Model Adult acute myeloid leukemia KG-1 cells CVCL_0374
Experiment 5 Reporting the Activity Date of This ADC [3]
Efficacy Data Tumor Growth Inhibition value (TGI)
51.00%
High CD37 expression (CD37+++; CD37 MFI ratio=300)
Method Description
The in vivo antitumor activity of AGS-67E was evaluated in a CD37 positive NHL,CLL and AmL cell line xenograft models. Depending on the cell line,110e6 cells were injected into the flanks of individual SCID mice,and tumor volumes were allowed to reach 100 to 300 mm3. Animals and their tumors were size matched and randomized into treatment and control groups. Depending on the study,AGS67E and an isotype control ADC were dosed by i.v. bolus injection either at 0.25,0.75,1.5,or 3.0 mg/kg at biweekly (BIW) or weekly (QW) frequencies and for a total of 2 to 4 doses.

   Click to Show/Hide
In Vivo Model CD37-expressing Mino MCL cancer xenograft model
In Vitro Model Mantle cell lymphoma Mino cells CVCL_1872
Experiment 6 Reporting the Activity Date of This ADC [3]
Efficacy Data Tumor Growth Inhibition value (TGI)
63.00%
Moderate CD37 expression (CD37++; CD37 MFI ratio=140)
Method Description
The in vivo antitumor activity of AGS-67E was evaluated in a CD37 positive NHL,CLL and AmL cell line xenograft models. Depending on the cell line,110e6 cells were injected into the flanks of individual SCID mice,and tumor volumes were allowed to reach 100 to 300 mm3. Animals and their tumors were size matched and randomized into treatment and control groups. Depending on the study,AGS67E and an isotype control ADC were dosed by i.v. bolus injection either at 0.25,0.75,1.5,or 3.0 mg/kg at biweekly (BIW) or weekly (QW) frequencies and for a total of 2 to 4 doses.

   Click to Show/Hide
In Vivo Model CD37-expressing Ramos-RR-XcL Burkitt lymphoma cancer xenograft model
In Vitro Model Burkitt lymphoma Ramos cells CVCL_0597
Experiment 7 Reporting the Activity Date of This ADC [3]
Efficacy Data Tumor Growth Inhibition value (TGI)
66.00%
High CD37 expression (CD37+++; CD37 MFI ratio=580)
Method Description
The in vivo antitumor activity of AGS-67E was evaluated in a CD37 positive NHL,CLL and AmL cell line xenograft models. Depending on the cell line,110e6 cells were injected into the flanks of individual SCID mice,and tumor volumes were allowed to reach 100 to 300 mm3. Animals and their tumors were size matched and randomized into treatment and control groups. Depending on the study,AGS67E and an isotype control ADC were dosed by i.v. bolus injection either at 0.25,0.75,1.5,or 3.0 mg/kg at biweekly (BIW) or weekly (QW) frequencies and for a total of 2 to 4 doses.

   Click to Show/Hide
In Vivo Model CD37-expressing DOHH2 FL cancer xenograft model
In Vitro Model Diffuse large B-cell lymphoma germinal center B-cell type DoHH2 cells CVCL_1179
Experiment 8 Reporting the Activity Date of This ADC [3]
Efficacy Data Tumor Growth Inhibition value (TGI)
69.00%
Low CD37 expression (CD37+; CD37 MFI ratio=25)
Method Description
The in vivo antitumor activity of AGS-67E was evaluated in a CD37 positive NHL,CLL and AmL cell line xenograft models. Depending on the cell line,110e6 cells were injected into the flanks of individual SCID mice,and tumor volumes were allowed to reach 100 to 300 mm3. Animals and their tumors were size matched and randomized into treatment and control groups. Depending on the study,AGS67E and an isotype control ADC were dosed by i.v. bolus injection either at 0.25,0.75,1.5,or 3.0 mg/kg at biweekly (BIW) or weekly (QW) frequencies and for a total of 2 to 4 doses.

   Click to Show/Hide
In Vivo Model CD37-expressing MOLM-13 AmL cancer xenograft model
In Vitro Model Adult acute myeloid leukemia MOLM-13 cells CVCL_2119
Experiment 9 Reporting the Activity Date of This ADC [3]
Efficacy Data Tumor Growth Inhibition value (TGI)
86.00%
Moderate CD37 expression (CD37++; CD37 MFI ratio=140)
Method Description
The in vivo antitumor activity of AGS-67E was evaluated in a CD37 positive NHL,CLL and AmL cell line xenograft models. Depending on the cell line,110e6 cells were injected into the flanks of individual SCID mice,and tumor volumes were allowed to reach 100 to 300 mm3. Animals and their tumors were size matched and randomized into treatment and control groups. Depending on the study,AGS67E and an isotype control ADC were dosed by i.v. bolus injection either at 0.25,0.75,1.5,or 3.0 mg/kg at biweekly (BIW) or weekly (QW) frequencies and for a total of 2 to 4 doses.

   Click to Show/Hide
In Vivo Model CD37-expressing Ramos-RR-XcL Burkitt lymphoma cancer xenograft model
In Vitro Model Burkitt lymphoma Ramos cells CVCL_0597
Experiment 10 Reporting the Activity Date of This ADC [3]
Efficacy Data Tumor Growth Inhibition value (TGI)
92.00%
High CD37 expression (CD37+++; CD37 MFI ratio=300)
Method Description
The in vivo antitumor activity of AGS-67E was evaluated in a CD37 positive NHL,CLL and AmL cell line xenograft models. Depending on the cell line,110e6 cells were injected into the flanks of individual SCID mice,and tumor volumes were allowed to reach 100 to 300 mm3. Animals and their tumors were size matched and randomized into treatment and control groups. Depending on the study,AGS67E and an isotype control ADC were dosed by i.v. bolus injection either at 0.25,0.75,1.5,or 3.0 mg/kg at biweekly (BIW) or weekly (QW) frequencies and for a total of 2 to 4 doses.

   Click to Show/Hide
In Vivo Model CD37-expressing Mino MCL cancer xenograft model
In Vitro Model Mantle cell lymphoma Mino cells CVCL_1872
Experiment 11 Reporting the Activity Date of This ADC [3]
Efficacy Data Tumor Growth Inhibition value (TGI)
95.00%
High CD37 expression (CD37+++; CD37 MFI ratio=580)
Method Description
The in vivo antitumor activity of AGS-67E was evaluated in a CD37 positive NHL,CLL and AmL cell line xenograft models. Depending on the cell line,110e6 cells were injected into the flanks of individual SCID mice,and tumor volumes were allowed to reach 100 to 300 mm3. Animals and their tumors were size matched and randomized into treatment and control groups. Depending on the study,AGS67E and an isotype control ADC were dosed by i.v. bolus injection either at 0.25,0.75,1.5,or 3.0 mg/kg at biweekly (BIW) or weekly (QW) frequencies and for a total of 2 to 4 doses.

   Click to Show/Hide
In Vivo Model CD37-expressing DOHH2 FL cancer xenograft model
In Vitro Model Diffuse large B-cell lymphoma germinal center B-cell type DoHH2 cells CVCL_1179
Experiment 12 Reporting the Activity Date of This ADC [3]
Efficacy Data Tumor Growth Inhibition value (TGI)
95.00%
Low CD37 expression (CD37+; CD37 MFI ratio=23)
Method Description
The in vivo antitumor activity of AGS-67E was evaluated in a CD37 positive NHL,CLL and AmL cell line xenograft models. Depending on the cell line,110e6 cells were injected into the flanks of individual SCID mice,and tumor volumes were allowed to reach 100 to 300 mm3. Animals and their tumors were size matched and randomized into treatment and control groups. Depending on the study,AGS67E and an isotype control ADC were dosed by i.v. bolus injection either at 0.25,0.75,1.5,or 3.0 mg/kg at biweekly (BIW) or weekly (QW) frequencies and for a total of 2 to 4 doses.

   Click to Show/Hide
In Vivo Model CD37-expressing THP-1 AmL cancer xenograft models
In Vitro Model Childhood acute monocytic leukemia THP-1 cells CVCL_0006
Experiment 13 Reporting the Activity Date of This ADC [3]
Efficacy Data Tumor Growth Inhibition value (TGI)
96.00%
High CD37 expression (CD37+++; CD37 MFI ratio=554)
Method Description
The in vivo antitumor activity of AGS-67E was evaluated in a CD37 positive NHL,CLL and AmL cell line xenograft models. Depending on the cell line,110e6 cells were injected into the flanks of individual SCID mice,and tumor volumes were allowed to reach 100 to 300 mm3. Animals and their tumors were size matched and randomized into treatment and control groups. Depending on the study,AGS67E and an isotype control ADC were dosed by i.v. bolus injection either at 0.25,0.75,1.5,or 3.0 mg/kg at biweekly (BIW) or weekly (QW) frequencies and for a total of 2 to 4 doses.

   Click to Show/Hide
In Vivo Model CD37-expressing WSU-DLCL2 DBCL cancer xenograft model
In Vitro Model Diffuse large B-cell lymphoma WSU-DLCL2 cells CVCL_1902
Experiment 14 Reporting the Activity Date of This ADC [3]
Efficacy Data Tumor Growth Inhibition value (TGI)
97.00%
Moderate CD37 expression (CD37++; CD37 MFI ratio=140)
Method Description
The in vivo antitumor activity of AGS-67E was evaluated in a CD37 positive NHL,CLL and AmL cell line xenograft models. Depending on the cell line,110e6 cells were injected into the flanks of individual SCID mice,and tumor volumes were allowed to reach 100 to 300 mm3. Animals and their tumors were size matched and randomized into treatment and control groups. Depending on the study,AGS67E and an isotype control ADC were dosed by i.v. bolus injection either at 0.25,0.75,1.5,or 3.0 mg/kg at biweekly (BIW) or weekly (QW) frequencies and for a total of 2 to 4 doses.

   Click to Show/Hide
In Vivo Model CD37-expressing Ramos-RR-XcL Burkitt lymphoma cancer xenograft model
In Vitro Model Burkitt lymphoma Ramos cells CVCL_0597
Experiment 15 Reporting the Activity Date of This ADC [3]
Efficacy Data Tumor Growth Inhibition value (TGI)
100.00%
Moderate CD37 expression (CD37++; CD37 MFI ratio=129)
Method Description
The in vivo antitumor activity of AGS-67E was evaluated in a CD37 positive NHL,CLL and AmL cell line xenograft models. Depending on the cell line,110e6 cells were injected into the flanks of individual SCID mice,and tumor volumes were allowed to reach 100 to 300 mm3. Animals and their tumors were size matched and randomized into treatment and control groups. Depending on the study,AGS67E and an isotype control ADC were dosed by i.v. bolus injection either at 0.25,0.75,1.5,or 3.0 mg/kg at biweekly (BIW) or weekly (QW) frequencies and for a total of 2 to 4 doses.

   Click to Show/Hide
In Vivo Model CD38-expressing JVM3 xenograft CLL cancer model
In Vitro Model B-cell prolymphocytic leukemia JVM-3 cells CVCL_1320
Experiment 16 Reporting the Activity Date of This ADC [3]
Efficacy Data Tumor Growth Inhibition value (TGI)
100.00%
Moderate CD37 expression (CD37++; CD37 MFI ratio=129)
Method Description
The in vivo antitumor activity of AGS-67E was evaluated in a CD37 positive NHL,CLL and AmL cell line xenograft models. Depending on the cell line,110e6 cells were injected into the flanks of individual SCID mice,and tumor volumes were allowed to reach 100 to 300 mm3. Animals and their tumors were size matched and randomized into treatment and control groups. Depending on the study,AGS67E and an isotype control ADC were dosed by i.v. bolus injection either at 0.25,0.75,1.5,or 3.0 mg/kg at biweekly (BIW) or weekly (QW) frequencies and for a total of 2 to 4 doses.

   Click to Show/Hide
In Vivo Model CD38-expressing JVM3 xenograft CLL cancer model
In Vitro Model B-cell prolymphocytic leukemia JVM-3 cells CVCL_1320
Experiment 17 Reporting the Activity Date of This ADC [3]
Efficacy Data Tumor Growth Inhibition value (TGI)
100.00%
Moderate CD37 expression (CD37++; CD37 MFI ratio=129)
Method Description
The in vivo antitumor activity of AGS-67E was evaluated in a CD37 positive NHL,CLL and AmL cell line xenograft models. Depending on the cell line,110e6 cells were injected into the flanks of individual SCID mice,and tumor volumes were allowed to reach 100 to 300 mm3. Animals and their tumors were size matched and randomized into treatment and control groups. Depending on the study,AGS67E and an isotype control ADC were dosed by i.v. bolus injection either at 0.25,0.75,1.5,or 3.0 mg/kg at biweekly (BIW) or weekly (QW) frequencies and for a total of 2 to 4 doses.

   Click to Show/Hide
In Vivo Model CD38-expressing JVM3 xenograft CLL cancer model
In Vitro Model B-cell prolymphocytic leukemia JVM-3 cells CVCL_1320
Experiment 18 Reporting the Activity Date of This ADC [3]
Efficacy Data Tumor Growth Inhibition value (TGI)
100.00%
Low CD37 expression (CD37+; CD37 MFI ratio=22)
Method Description
The in vivo antitumor activity of AGS-67E was evaluated in a CD37 positive NHL,CLL and AmL cell line xenograft models. Depending on the cell line,110e6 cells were injected into the flanks of individual SCID mice,and tumor volumes were allowed to reach 100 to 300 mm3. Animals and their tumors were size matched and randomized into treatment and control groups. Depending on the study,AGS67E and an isotype control ADC were dosed by i.v. bolus injection either at 0.25,0.75,1.5,or 3.0 mg/kg at biweekly (BIW) or weekly (QW) frequencies and for a total of 2 to 4 doses.

   Click to Show/Hide
In Vivo Model CD38-expressing MV-411 AmL cancer xenograft model
In Vitro Model Childhood acute monocytic leukemia MV4-11 cells CVCL_0064
Experiment 19 Reporting the Activity Date of This ADC [3]
Efficacy Data Tumor Growth Inhibition value (TGI)
100.00%
Low CD37 expression (CD37+; CD37 MFI ratio=22)
Method Description
The in vivo antitumor activity of AGS-67E was evaluated in a CD37 positive NHL,CLL and AmL cell line xenograft models. Depending on the cell line,110e6 cells were injected into the flanks of individual SCID mice,and tumor volumes were allowed to reach 100 to 300 mm3. Animals and their tumors were size matched and randomized into treatment and control groups. Depending on the study,AGS67E and an isotype control ADC were dosed by i.v. bolus injection either at 0.25,0.75,1.5,or 3.0 mg/kg at biweekly (BIW) or weekly (QW) frequencies and for a total of 2 to 4 doses.

   Click to Show/Hide
In Vivo Model CD38-expressing MV-411 AmL cancer xenograft model
In Vitro Model Childhood acute monocytic leukemia MV4-11 cells CVCL_0064
Experiment 20 Reporting the Activity Date of This ADC [3]
Efficacy Data Tumor Growth Inhibition value (TGI)
100.00%
Low CD37 expression (CD37+; CD37 MFI ratio=22)
Method Description
The in vivo antitumor activity of AGS-67E was evaluated in a CD37 positive NHL,CLL and AmL cell line xenograft models. Depending on the cell line,110e6 cells were injected into the flanks of individual SCID mice,and tumor volumes were allowed to reach 100 to 300 mm3. Animals and their tumors were size matched and randomized into treatment and control groups. Depending on the study,AGS67E and an isotype control ADC were dosed by i.v. bolus injection either at 0.25,0.75,1.5,or 3.0 mg/kg at biweekly (BIW) or weekly (QW) frequencies and for a total of 2 to 4 doses.

   Click to Show/Hide
In Vivo Model CD38-expressing MV-411 AmL cancer xenograft model
In Vitro Model Childhood acute monocytic leukemia MV4-11 cells CVCL_0064
Experiment 21 Reporting the Activity Date of This ADC [3]
Efficacy Data Tumor Growth Inhibition value (TGI)
100.00%
Low CD37 expression (CD37+; CD37 MFI ratio=25)
Method Description
The in vivo antitumor activity of AGS-67E was evaluated in a CD37 positive NHL,CLL and AmL cell line xenograft models. Depending on the cell line,110e6 cells were injected into the flanks of individual SCID mice,and tumor volumes were allowed to reach 100 to 300 mm3. Animals and their tumors were size matched and randomized into treatment and control groups. Depending on the study,AGS67E and an isotype control ADC were dosed by i.v. bolus injection either at 0.25,0.75,1.5,or 3.0 mg/kg at biweekly (BIW) or weekly (QW) frequencies and for a total of 2 to 4 doses.

   Click to Show/Hide
In Vivo Model CD37-expressing MOLM-13 AmL cancer xenograft model
In Vitro Model Adult acute myeloid leukemia MOLM-13 cells CVCL_2119
Experiment 22 Reporting the Activity Date of This ADC [3]
Efficacy Data Tumor Growth Inhibition value (TGI)
100.00%
Low CD37 expression (CD37+; CD37 MFI ratio=25)
Method Description
The in vivo antitumor activity of AGS-67E was evaluated in a CD37 positive NHL,CLL and AmL cell line xenograft models. Depending on the cell line,110e6 cells were injected into the flanks of individual SCID mice,and tumor volumes were allowed to reach 100 to 300 mm3. Animals and their tumors were size matched and randomized into treatment and control groups. Depending on the study,AGS67E and an isotype control ADC were dosed by i.v. bolus injection either at 0.25,0.75,1.5,or 3.0 mg/kg at biweekly (BIW) or weekly (QW) frequencies and for a total of 2 to 4 doses.

   Click to Show/Hide
In Vivo Model CD37-expressing MOLM-13 AmL cancer xenograft model
In Vitro Model Adult acute myeloid leukemia MOLM-13 cells CVCL_2119
Revealed Based on the Cell Line Data
Click To Hide/Show 25 Activity Data Related to This Level
Experiment 1 Reporting the Activity Date of This ADC [3]
Efficacy Data Half Maximal Inhibitory Concentration (IC50)
0.05±0.03 nM
Low CD37 expression (CD37+; CD37 MFI ratio=25)
Method Description
The inhibitory activity of AGS-67E against cancer cell growth was evaluated in various human cancer cell lines in vitro. Exponentially growing cells with a viability of 95% or greater were plated in fresh RPMI-1640 (Gibco-Invitrogen) media containing phenol red supplemented with 10% FBS (heat inactivated),10 mmol/L Hepes,and 1 mmol/L sodium pyruvate. Cells were left overnight and treated with AGS67E and an isotype control. After 5 days of treatment and incubation at 37°C and 5% CO2,cell viability was measured following a 1 hour incubation at 37°C with Presto Blue Reagent (Invitrogen).

   Click to Show/Hide
In Vitro Model Burkitt lymphoma Ramos cells CVCL_0597
Experiment 2 Reporting the Activity Date of This ADC [3]
Efficacy Data Half Maximal Inhibitory Concentration (IC50)
0.07±0.49 nM
Low CD37 expression (CD37+; CD37 MFI ratio=18)
Method Description
The inhibitory activity of AGS-67E against cancer cell growth was evaluated in various human cancer cell lines in vitro. Exponentially growing cells with a viability of 95% or greater were plated in fresh RPMI-1640 (Gibco-Invitrogen) media containing phenol red supplemented with 10% FBS (heat inactivated),10 mmol/L Hepes,and 1 mmol/L sodium pyruvate. Cells were left overnight and treated with AGS67E and an isotype control. After 5 days of treatment and incubation at 37°C and 5% CO2,cell viability was measured following a 1 hour incubation at 37°C with Presto Blue Reagent (Invitrogen).

   Click to Show/Hide
In Vitro Model Mantle cell lymphoma Mino cells CVCL_1872
Experiment 3 Reporting the Activity Date of This ADC [3]
Efficacy Data Half Maximal Inhibitory Concentration (IC50)
0.08±0.02 nM
Method Description
The inhibitory activity of AGS-67E against cancer cell growth was evaluated in various human cancer cell lines in vitro. Exponentially growing cells with a viability of 95% or greater were plated in fresh RPMI-1640 (Gibco-Invitrogen) media containing phenol red supplemented with 10% FBS (heat inactivated),10 mmol/L Hepes,and 1 mmol/L sodium pyruvate. Cells were left overnight and treated with AGS67E and an isotype control. After 5 days of treatment and incubation at 37°C and 5% CO2,cell viability was measured following a 1 hour incubation at 37°C with Presto Blue Reagent (Invitrogen).

   Click to Show/Hide
In Vitro Model Burkitt lymphoma Daudi cells CVCL_0008
Experiment 4 Reporting the Activity Date of This ADC [3]
Efficacy Data Half Maximal Inhibitory Concentration (IC50)
0.08±0.61 nM
Negative CD37 expression (CD37-; CD37 MFI ratio=3)
Method Description
The inhibitory activity of AGS-67E against cancer cell growth was evaluated in various human cancer cell lines in vitro. Exponentially growing cells with a viability of 95% or greater were plated in fresh RPMI-1640 (Gibco-Invitrogen) media containing phenol red supplemented with 10% FBS (heat inactivated),10 mmol/L Hepes,and 1 mmol/L sodium pyruvate. Cells were left overnight and treated with AGS67E and an isotype control. After 5 days of treatment and incubation at 37°C and 5% CO2,cell viability was measured following a 1 hour incubation at 37°C with Presto Blue Reagent (Invitrogen).

   Click to Show/Hide
In Vitro Model Mantle cell lymphoma Granta-519 cells CVCL_1818
Experiment 5 Reporting the Activity Date of This ADC [3]
Efficacy Data Half Maximal Inhibitory Concentration (IC50)
0.13±0.08 nM
High CD37 expression (CD37+++; CD37 MFI ratio=662)
Method Description
The inhibitory activity of AGS-67E against cancer cell growth was evaluated in various human cancer cell lines in vitro. Exponentially growing cells with a viability of 95% or greater were plated in fresh RPMI-1640 (Gibco-Invitrogen) media containing phenol red supplemented with 10% FBS (heat inactivated),10 mmol/L Hepes,and 1 mmol/L sodium pyruvate. Cells were left overnight and treated with AGS67E and an isotype control. After 5 days of treatment and incubation at 37°C and 5% CO2,cell viability was measured following a 1 hour incubation at 37°C with Presto Blue Reagent (Invitrogen).

   Click to Show/Hide
In Vitro Model Childhood acute monocytic leukemia THP-1 cells CVCL_0006
Experiment 6 Reporting the Activity Date of This ADC [3]
Efficacy Data Half Maximal Inhibitory Concentration (IC50)
0.23±0.30 nM
High CD37 expression (CD37+++; CD37 MFI ratio=534)
Method Description
The inhibitory activity of AGS-67E against cancer cell growth was evaluated in various human cancer cell lines in vitro. Exponentially growing cells with a viability of 95% or greater were plated in fresh RPMI-1640 (Gibco-Invitrogen) media containing phenol red supplemented with 10% FBS (heat inactivated),10 mmol/L Hepes,and 1 mmol/L sodium pyruvate. Cells were left overnight and treated with AGS67E and an isotype control. After 5 days of treatment and incubation at 37°C and 5% CO2,cell viability was measured following a 1 hour incubation at 37°C with Presto Blue Reagent (Invitrogen).

   Click to Show/Hide
In Vitro Model Diffuse large B-cell lymphoma SU-DHL-4 cells CVCL_0539
Experiment 7 Reporting the Activity Date of This ADC [3]
Efficacy Data Half Maximal Inhibitory Concentration (IC50)
0.50±0.72 nM
High CD37 expression (CD37+++; CD37 MFI ratio=581)
Method Description
The inhibitory activity of AGS-67E against cancer cell growth was evaluated in various human cancer cell lines in vitro. Exponentially growing cells with a viability of 95% or greater were plated in fresh RPMI-1640 (Gibco-Invitrogen) media containing phenol red supplemented with 10% FBS (heat inactivated),10 mmol/L Hepes,and 1 mmol/L sodium pyruvate. Cells were left overnight and treated with AGS67E and an isotype control. After 5 days of treatment and incubation at 37°C and 5% CO2,cell viability was measured following a 1 hour incubation at 37°C with Presto Blue Reagent (Invitrogen).

   Click to Show/Hide
In Vitro Model B-cell prolymphocytic leukemia JVM-3 cells CVCL_1320
Experiment 8 Reporting the Activity Date of This ADC [3]
Efficacy Data Half Maximal Inhibitory Concentration (IC50)
0.71±0.20 nM
Low CD37 expression (CD37+; CD37 MFI ratio=22)
Method Description
The inhibitory activity of AGS-67E against cancer cell growth was evaluated in various human cancer cell lines in vitro. Exponentially growing cells with a viability of 95% or greater were plated in fresh RPMI-1640 (Gibco-Invitrogen) media containing phenol red supplemented with 10% FBS (heat inactivated),10 mmol/L Hepes,and 1 mmol/L sodium pyruvate. Cells were left overnight and treated with AGS67E and an isotype control. After 5 days of treatment and incubation at 37°C and 5% CO2,cell viability was measured following a 1 hour incubation at 37°C with Presto Blue Reagent (Invitrogen).

   Click to Show/Hide
In Vitro Model Acute myeloid leukemia SKM-1 cells CVCL_0098
Experiment 9 Reporting the Activity Date of This ADC [3]
Efficacy Data Half Maximal Inhibitory Concentration (IC50)
0.98±1.10 nM
Negative CD37 expression (CD37-; CD37 MFI ratio=9)
Method Description
The inhibitory activity of AGS-67E against cancer cell growth was evaluated in various human cancer cell lines in vitro. Exponentially growing cells with a viability of 95% or greater were plated in fresh RPMI-1640 (Gibco-Invitrogen) media containing phenol red supplemented with 10% FBS (heat inactivated),10 mmol/L Hepes,and 1 mmol/L sodium pyruvate. Cells were left overnight and treated with AGS67E and an isotype control. After 5 days of treatment and incubation at 37°C and 5% CO2,cell viability was measured following a 1 hour incubation at 37°C with Presto Blue Reagent (Invitrogen).

   Click to Show/Hide
In Vitro Model Diffuse large B-cell lymphoma germinal center B-cell type DoHH2 cells CVCL_1179
Experiment 10 Reporting the Activity Date of This ADC [3]
Efficacy Data Half Maximal Inhibitory Concentration (IC50)
1.10±0.60 nM
Moderate CD37 expression (CD37++; CD37 MFI ratio=129)
Method Description
The inhibitory activity of AGS-67E against cancer cell growth was evaluated in various human cancer cell lines in vitro. Exponentially growing cells with a viability of 95% or greater were plated in fresh RPMI-1640 (Gibco-Invitrogen) media containing phenol red supplemented with 10% FBS (heat inactivated),10 mmol/L Hepes,and 1 mmol/L sodium pyruvate. Cells were left overnight and treated with AGS67E and an isotype control. After 5 days of treatment and incubation at 37°C and 5% CO2,cell viability was measured following a 1 hour incubation at 37°C with Presto Blue Reagent (Invitrogen).

   Click to Show/Hide
In Vitro Model Adult acute myeloid leukemia OCI-AML-2 cells CVCL_1619
Experiment 11 Reporting the Activity Date of This ADC [3]
Efficacy Data Half Maximal Inhibitory Concentration (IC50)
1.20±0.90 nM
Negative CD37 expression (CD37-; CD37 MFI ratio=1)
Method Description
The inhibitory activity of AGS-67E against cancer cell growth was evaluated in various human cancer cell lines in vitro. Exponentially growing cells with a viability of 95% or greater were plated in fresh RPMI-1640 (Gibco-Invitrogen) media containing phenol red supplemented with 10% FBS (heat inactivated),10 mmol/L Hepes,and 1 mmol/L sodium pyruvate. Cells were left overnight and treated with AGS67E and an isotype control. After 5 days of treatment and incubation at 37°C and 5% CO2,cell viability was measured following a 1 hour incubation at 37°C with Presto Blue Reagent (Invitrogen).

   Click to Show/Hide
In Vitro Model Childhood acute monocytic leukemia MV4-11 cells CVCL_0064
Experiment 12 Reporting the Activity Date of This ADC [3]
Efficacy Data Half Maximal Inhibitory Concentration (IC50)
1.30±0.50 nM
Low CD37 expression (CD37+; CD37 MFI ratio=20)
Method Description
The inhibitory activity of AGS-67E against cancer cell growth was evaluated in various human cancer cell lines in vitro. Exponentially growing cells with a viability of 95% or greater were plated in fresh RPMI-1640 (Gibco-Invitrogen) media containing phenol red supplemented with 10% FBS (heat inactivated),10 mmol/L Hepes,and 1 mmol/L sodium pyruvate. Cells were left overnight and treated with AGS67E and an isotype control. After 5 days of treatment and incubation at 37°C and 5% CO2,cell viability was measured following a 1 hour incubation at 37°C with Presto Blue Reagent (Invitrogen).

   Click to Show/Hide
In Vitro Model Adult acute myeloid leukemia MOLM-13 cells CVCL_2119
Experiment 13 Reporting the Activity Date of This ADC [3]
Efficacy Data Half Maximal Inhibitory Concentration (IC50)
3.50±0.70 nM
Low CD37 expression (CD37+; CD37 MFI ratio=11)
Method Description
The inhibitory activity of AGS-67E against cancer cell growth was evaluated in various human cancer cell lines in vitro. Exponentially growing cells with a viability of 95% or greater were plated in fresh RPMI-1640 (Gibco-Invitrogen) media containing phenol red supplemented with 10% FBS (heat inactivated),10 mmol/L Hepes,and 1 mmol/L sodium pyruvate. Cells were left overnight and treated with AGS67E and an isotype control. After 5 days of treatment and incubation at 37°C and 5% CO2,cell viability was measured following a 1 hour incubation at 37°C with Presto Blue Reagent (Invitrogen).

   Click to Show/Hide
In Vitro Model Myeloid leukemia with maturation Kasumi-1 cells CVCL_0589
Experiment 14 Reporting the Activity Date of This ADC [3]
Efficacy Data Half Maximal Inhibitory Concentration (IC50)
5.70±1.60 nM
Low CD37 expression (CD37+; CD37 MFI ratio=26)
Method Description
The inhibitory activity of AGS-67E against cancer cell growth was evaluated in various human cancer cell lines in vitro. Exponentially growing cells with a viability of 95% or greater were plated in fresh RPMI-1640 (Gibco-Invitrogen) media containing phenol red supplemented with 10% FBS (heat inactivated),10 mmol/L Hepes,and 1 mmol/L sodium pyruvate. Cells were left overnight and treated with AGS67E and an isotype control. After 5 days of treatment and incubation at 37°C and 5% CO2,cell viability was measured following a 1 hour incubation at 37°C with Presto Blue Reagent (Invitrogen).

   Click to Show/Hide
In Vitro Model Acute myeloid leukemia BDCM cells CVCL_4613
Experiment 15 Reporting the Activity Date of This ADC [3]
Efficacy Data Half Maximal Inhibitory Concentration (IC50)
19.70±3.00 nM
High CD37 expression (CD37+++; CD37 MFI ratio=341)
Method Description
The inhibitory activity of AGS-67E against cancer cell growth was evaluated in various human cancer cell lines in vitro. Exponentially growing cells with a viability of 95% or greater were plated in fresh RPMI-1640 (Gibco-Invitrogen) media containing phenol red supplemented with 10% FBS (heat inactivated),10 mmol/L Hepes,and 1 mmol/L sodium pyruvate. Cells were left overnight and treated with AGS67E and an isotype control. After 5 days of treatment and incubation at 37°C and 5% CO2,cell viability was measured following a 1 hour incubation at 37°C with Presto Blue Reagent (Invitrogen).

   Click to Show/Hide
In Vitro Model Diffuse large B-cell lymphoma WSU-DLCL2 cells CVCL_1902
Experiment 16 Reporting the Activity Date of This ADC [3]
Efficacy Data Half Maximal Inhibitory Concentration (IC50) > 10.00 uM High CD37 expression (CD37+++; CD37 MFI ratio=301)
Method Description
The inhibitory activity of AGS-67E against cancer cell growth was evaluated in various human cancer cell lines in vitro. Exponentially growing cells with a viability of 95% or greater were plated in fresh RPMI-1640 (Gibco-Invitrogen) media containing phenol red supplemented with 10% FBS (heat inactivated),10 mmol/L Hepes,and 1 mmol/L sodium pyruvate. Cells were left overnight and treated with AGS67E and an isotype control. After 5 days of treatment and incubation at 37°C and 5% CO2,cell viability was measured following a 1 hour incubation at 37°C with Presto Blue Reagent (Invitrogen).

   Click to Show/Hide
In Vitro Model Mantle cell lymphoma REC-1 cells CVCL_1884
Experiment 17 Reporting the Activity Date of This ADC [3]
Efficacy Data Half Maximal Inhibitory Concentration (IC50) > 10.00 uM High CD37 expression (CD37+++; CD37 MFI ratio=554)
Method Description
The inhibitory activity of AGS-67E against cancer cell growth was evaluated in various human cancer cell lines in vitro. Exponentially growing cells with a viability of 95% or greater were plated in fresh RPMI-1640 (Gibco-Invitrogen) media containing phenol red supplemented with 10% FBS (heat inactivated),10 mmol/L Hepes,and 1 mmol/L sodium pyruvate. Cells were left overnight and treated with AGS67E and an isotype control. After 5 days of treatment and incubation at 37°C and 5% CO2,cell viability was measured following a 1 hour incubation at 37°C with Presto Blue Reagent (Invitrogen).

   Click to Show/Hide
In Vitro Model Acute myeloid leukemia PL-21 cells CVCL_2161
Experiment 18 Reporting the Activity Date of This ADC [3]
Efficacy Data Half Maximal Inhibitory Concentration (IC50) > 10.00 uM Low CD37 expression (CD37+; CD37 MFI ratio=39)
Method Description
The inhibitory activity of AGS-67E against cancer cell growth was evaluated in various human cancer cell lines in vitro. Exponentially growing cells with a viability of 95% or greater were plated in fresh RPMI-1640 (Gibco-Invitrogen) media containing phenol red supplemented with 10% FBS (heat inactivated),10 mmol/L Hepes,and 1 mmol/L sodium pyruvate. Cells were left overnight and treated with AGS67E and an isotype control. After 5 days of treatment and incubation at 37°C and 5% CO2,cell viability was measured following a 1 hour incubation at 37°C with Presto Blue Reagent (Invitrogen).

   Click to Show/Hide
In Vitro Model Chronic eosinophilic leukemia EoL-1 cells CVCL_0258
Experiment 19 Reporting the Activity Date of This ADC [3]
Efficacy Data Half Maximal Inhibitory Concentration (IC50) > 10.00 uM High CD37 expression (CD37+++; CD37 MFI ratio=372)
Method Description
The inhibitory activity of AGS-67E against cancer cell growth was evaluated in various human cancer cell lines in vitro. Exponentially growing cells with a viability of 95% or greater were plated in fresh RPMI-1640 (Gibco-Invitrogen) media containing phenol red supplemented with 10% FBS (heat inactivated),10 mmol/L Hepes,and 1 mmol/L sodium pyruvate. Cells were left overnight and treated with AGS67E and an isotype control. After 5 days of treatment and incubation at 37°C and 5% CO2,cell viability was measured following a 1 hour incubation at 37°C with Presto Blue Reagent (Invitrogen).

   Click to Show/Hide
In Vitro Model Adult acute myeloid leukemia HL-60 cells CVCL_0002
Experiment 20 Reporting the Activity Date of This ADC [3]
Efficacy Data Half Maximal Inhibitory Concentration (IC50) > 10.00 uM Negative CD37 expression (CD37-; CD37 MFI ratio=4)
Method Description
The inhibitory activity of AGS-67E against cancer cell growth was evaluated in various human cancer cell lines in vitro. Exponentially growing cells with a viability of 95% or greater were plated in fresh RPMI-1640 (Gibco-Invitrogen) media containing phenol red supplemented with 10% FBS (heat inactivated),10 mmol/L Hepes,and 1 mmol/L sodium pyruvate. Cells were left overnight and treated with AGS67E and an isotype control. After 5 days of treatment and incubation at 37°C and 5% CO2,cell viability was measured following a 1 hour incubation at 37°C with Presto Blue Reagent (Invitrogen).

   Click to Show/Hide
In Vitro Model Adult acute megakaryoblastic leukemia UT-7 cells CVCL_2233
Experiment 21 Reporting the Activity Date of This ADC [3]
Efficacy Data Half Maximal Inhibitory Concentration (IC50) > 10.00 uM Negative CD37 expression (CD37-; CD37 MFI ratio=5)
Method Description
The inhibitory activity of AGS-67E against cancer cell growth was evaluated in various human cancer cell lines in vitro. Exponentially growing cells with a viability of 95% or greater were plated in fresh RPMI-1640 (Gibco-Invitrogen) media containing phenol red supplemented with 10% FBS (heat inactivated),10 mmol/L Hepes,and 1 mmol/L sodium pyruvate. Cells were left overnight and treated with AGS67E and an isotype control. After 5 days of treatment and incubation at 37°C and 5% CO2,cell viability was measured following a 1 hour incubation at 37°C with Presto Blue Reagent (Invitrogen).

   Click to Show/Hide
In Vitro Model Adult acute myeloid leukemia KG-1 cells CVCL_0374
Experiment 22 Reporting the Activity Date of This ADC [3]
Efficacy Data Half Maximal Inhibitory Concentration (IC50) > 10.00 uM Low CD37 expression (CD37+; CD37 MFI ratio=30)
Method Description
The inhibitory activity of AGS-67E against cancer cell growth was evaluated in various human cancer cell lines in vitro. Exponentially growing cells with a viability of 95% or greater were plated in fresh RPMI-1640 (Gibco-Invitrogen) media containing phenol red supplemented with 10% FBS (heat inactivated),10 mmol/L Hepes,and 1 mmol/L sodium pyruvate. Cells were left overnight and treated with AGS67E and an isotype control. After 5 days of treatment and incubation at 37°C and 5% CO2,cell viability was measured following a 1 hour incubation at 37°C with Presto Blue Reagent (Invitrogen).

   Click to Show/Hide
In Vitro Model Down syndrome CMK cells CVCL_0216
Experiment 23 Reporting the Activity Date of This ADC [3]
Efficacy Data Half Maximal Inhibitory Concentration (IC50) > 10.00 uM Low CD37 expression (CD37+; CD37 MFI ratio=10)
Method Description
The inhibitory activity of AGS-67E against cancer cell growth was evaluated in various human cancer cell lines in vitro. Exponentially growing cells with a viability of 95% or greater were plated in fresh RPMI-1640 (Gibco-Invitrogen) media containing phenol red supplemented with 10% FBS (heat inactivated),10 mmol/L Hepes,and 1 mmol/L sodium pyruvate. Cells were left overnight and treated with AGS67E and an isotype control. After 5 days of treatment and incubation at 37°C and 5% CO2,cell viability was measured following a 1 hour incubation at 37°C with Presto Blue Reagent (Invitrogen).

   Click to Show/Hide
In Vitro Model Acute erythroid leukemia TF-1a cells CVCL_3608
Experiment 24 Reporting the Activity Date of This ADC [3]
Efficacy Data Half Maximal Inhibitory Concentration (IC50) > 10.00 uM Low CD37 expression (CD37+; CD37 MFI ratio=64)
Method Description
The inhibitory activity of AGS-67E against cancer cell growth was evaluated in various human cancer cell lines in vitro. Exponentially growing cells with a viability of 95% or greater were plated in fresh RPMI-1640 (Gibco-Invitrogen) media containing phenol red supplemented with 10% FBS (heat inactivated),10 mmol/L Hepes,and 1 mmol/L sodium pyruvate. Cells were left overnight and treated with AGS67E and an isotype control. After 5 days of treatment and incubation at 37°C and 5% CO2,cell viability was measured following a 1 hour incubation at 37°C with Presto Blue Reagent (Invitrogen).

   Click to Show/Hide
In Vitro Model Acute erythroid leukemia HEL 92.1 cells CVCL_2481
Experiment 25 Reporting the Activity Date of This ADC [3]
Efficacy Data Half Maximal Inhibitory Concentration (IC50) > 10.00 uM Low CD37 expression (CD37+; CD37 MFI ratio=23)
Method Description
The inhibitory activity of AGS-67E against cancer cell growth was evaluated in various human cancer cell lines in vitro. Exponentially growing cells with a viability of 95% or greater were plated in fresh RPMI-1640 (Gibco-Invitrogen) media containing phenol red supplemented with 10% FBS (heat inactivated),10 mmol/L Hepes,and 1 mmol/L sodium pyruvate. Cells were left overnight and treated with AGS67E and an isotype control. After 5 days of treatment and incubation at 37°C and 5% CO2,cell viability was measured following a 1 hour incubation at 37°C with Presto Blue Reagent (Invitrogen).

   Click to Show/Hide
In Vitro Model Adult T acute lymphoblastic leukemia MOLT-4 cells CVCL_0013
References
Ref 1 A phase 1 study of the anti-CD37 antibody-drug conjugate AGS67E in advanced lymphoid malignancies. interim results. Hematol Oncol. 2017 Jun 7;35(S2):supplement 14-17.
Ref 2 A Phase 1 Study Evaluating Safety, Tolerability, and Pharmacokinetics of Escalating Doses of AGS67E Given as Monotherapy in Subjects With Acute Myeloid Leukemia (AML), NCT02610062
Ref 3 AGS67E, an Anti-CD37 Monomethyl Auristatin E Antibody-Drug Conjugate as a Potential Therapeutic for B/T-Cell Malignancies and AML: A New Role for CD37 in AML. Mol Cancer Ther. 2015 Jul;14(7):1650-60.

If you find any error in data or bug in web service, please kindly report it to Dr. Shen et al.