Antibody Information
General Information of This Antibody
| Antibody ID | ANI0HRZCS |
|||||
|---|---|---|---|---|---|---|
| Antibody Name | AGS67C |
|||||
| Antibody Type | Monoclonal antibody (mAb) |
|||||
| Antibody Subtype | Humanized IgG2-kappa |
|||||
| Antigen Name | Leukocyte antigen CD37 (CD37) |
Antigen Info | ||||
| Click to Show/Hide the Sequence Information of This Antibody | ||||||
| Heavy Chain Sequence |
QVQLQQWGAGLLKPSETLSLTCAVYGGSFSPYYWSWIRQPPGKGLEWIGEINHSGSTNYN
PSLKSRVTISVDTSKNQFSLKLSSVTAADTAVYYCARRAGDFDYWGQGTLVTVSSASTKG PSVFPLAPCSRSTSESTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSL SSVVTVPSSNFGTQTYTCNVDHKPSNTKVDKTVERKCCVECPPCPAPPVAGPSVFLFPPK PKDTLMISRTPEVTCVVVDVSHEDPEVQFNWYVDGVEVHNAKTKPREEQFNSTFRVVSVL TVVHQDWLNGKEYKCKVSNKGLPAPIEKTISKTKGQPREPQVYTLPPSREEMTKNQVSLT CLVKGFYPSDIAVEWESNGQPENNYKTTPPMLDSDGSFFLYSKLTVDKSRWQQGNVFSCS VMHEALHNHYTQKSLSLSPGK Click to Show/Hide
|
|||||
| Light Chain Sequence |
DIQMTQSPSTLSASVGDRVTITCRASQSISSWLAWYQQKPGKAPKLLIYKASSLESGVPS
RFSGSGSGTEFTLTISSLQPDDFATYYCQQYNSYIFGQGTKLEIKRTVAAPSVFIFPPSD EQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLS KADYEKHKVYACEVTHQGLSSPVTKSFNRGEC Click to Show/Hide
|
|||||
Each Antibody-drug Conjugate Related to This Antibody
Full Information of The Activity Data of The ADC(s) Related to This Antibody
AGS-67E [Phase 1 (Terminated)]
Identified from the Human Clinical Data
| Experiment 1 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Objective Response Rate (ORR) |
24.00% (0.9
1.2 and 1.5 mg/kg) |
Low CD37 expression (CD37+; CD37 MFI ratio=82) | ||
| Patients Enrolled |
Relapsed / refractory non Hodgkin lymphomas (NHLs) and chronic lymphocytic leukemia (CLL).
|
||||
| Administration Dosage |
Administered intravenously (IV) once every 3 weeks (Q3 weeks) until disease progression or unacceptable toxicity.
|
||||
| Related Clinical Trial | |||||
| NCT Number | NCT02175433 | Clinical Status | Phase 1 | ||
| Clinical Description |
A phase 1 study evaluating safety, tolerability, and pharmacokinetics of escalating doses of AGS67E given as monotherapy in subjects with refractory or relapsed lymphoid malignancies.
|
||||
| Experiment 2 Reporting the Activity Date of This ADC | [2] | ||||
| Related Clinical Trial | |||||
| NCT Number | NCT02610062 | Clinical Status | Phase 1 | ||
| Clinical Description |
A phase 1 study evaluating safety, tolerability, and pharmacokinetics of escalating doses of AGS67E given as monotherapy in subjects with acute myeloid leukemia (AML).
|
||||
Discovered Using Cell Line-derived Xenograft Model
| Experiment 1 Reporting the Activity Date of This ADC | [3] | ||||
| Efficacy Data | Tumor Growth Inhibition value (TGI) |
0.00%
|
Low CD37 expression (CD37+; CD37 MFI ratio=82) | ||
| Method Description |
The in vivo antitumor activity of AGS-67E was evaluated in a CD37 positive NHL,CLL and AmL cell line xenograft models. Depending on the cell line,110e6 cells were injected into the flanks of individual SCID mice,and tumor volumes were allowed to reach 100 to 300 mm3. Animals and their tumors were size matched and randomized into treatment and control groups. Depending on the study,AGS67E and an isotype control ADC were dosed by i.v. bolus injection either at 0.25,0.75,1.5,or 3.0 mg/kg at biweekly (BIW) or weekly (QW) frequencies and for a total of 2 to 4 doses.
Click to Show/Hide
|
||||
| In Vivo Model | CD37-expressing Hel 92.1.7 AmL cancer xenograft model | ||||
| In Vitro Model | Erythroleukemia | HEL 92.1.7 cells | CVCL_2481 | ||
| Experiment 2 Reporting the Activity Date of This ADC | [3] | ||||
| Efficacy Data | Tumor Growth Inhibition value (TGI) |
27.00%
|
High CD37 expression (CD37+++; CD37 MFI ratio=580) | ||
| Method Description |
The in vivo antitumor activity of AGS-67E was evaluated in a CD37 positive NHL,CLL and AmL cell line xenograft models. Depending on the cell line,110e6 cells were injected into the flanks of individual SCID mice,and tumor volumes were allowed to reach 100 to 300 mm3. Animals and their tumors were size matched and randomized into treatment and control groups. Depending on the study,AGS67E and an isotype control ADC were dosed by i.v. bolus injection either at 0.25,0.75,1.5,or 3.0 mg/kg at biweekly (BIW) or weekly (QW) frequencies and for a total of 2 to 4 doses.
Click to Show/Hide
|
||||
| In Vivo Model | CD37-expressing DOHH2 FL cancer xenograft model | ||||
| In Vitro Model | Diffuse large B-cell lymphoma germinal center B-cell type | DoHH2 cells | CVCL_1179 | ||
| Experiment 3 Reporting the Activity Date of This ADC | [3] | ||||
| Efficacy Data | Tumor Growth Inhibition value (TGI) |
31.00%
|
High CD37 expression (CD37+++; CD37 MFI ratio=554) | ||
| Method Description |
The in vivo antitumor activity of AGS-67E was evaluated in a CD37 positive NHL,CLL and AmL cell line xenograft models. Depending on the cell line,110e6 cells were injected into the flanks of individual SCID mice,and tumor volumes were allowed to reach 100 to 300 mm3. Animals and their tumors were size matched and randomized into treatment and control groups. Depending on the study,AGS67E and an isotype control ADC were dosed by i.v. bolus injection either at 0.25,0.75,1.5,or 3.0 mg/kg at biweekly (BIW) or weekly (QW) frequencies and for a total of 2 to 4 doses.
Click to Show/Hide
|
||||
| In Vivo Model | CD37-expressing WSU-DLCL2 DBCL cancer xenograft model | ||||
| In Vitro Model | Diffuse large B-cell lymphoma | WSU-DLCL2 cells | CVCL_1902 | ||
| Experiment 4 Reporting the Activity Date of This ADC | [3] | ||||
| Efficacy Data | Tumor Growth Inhibition value (TGI) |
41.00%
|
Low CD37 expression (CD37+; CD37 MFI ratio=20) | ||
| Method Description |
The in vivo antitumor activity of AGS-67E was evaluated in a CD37 positive NHL,CLL and AmL cell line xenograft models. Depending on the cell line,110e6 cells were injected into the flanks of individual SCID mice,and tumor volumes were allowed to reach 100 to 300 mm3. Animals and their tumors were size matched and randomized into treatment and control groups. Depending on the study,AGS67E and an isotype control ADC were dosed by i.v. bolus injection either at 0.25,0.75,1.5,or 3.0 mg/kg at biweekly (BIW) or weekly (QW) frequencies and for a total of 2 to 4 doses.
Click to Show/Hide
|
||||
| In Vivo Model | CD37-expressing KG-1 AmL cancer xenograft model | ||||
| In Vitro Model | Adult acute myeloid leukemia | KG-1 cells | CVCL_0374 | ||
| Experiment 5 Reporting the Activity Date of This ADC | [3] | ||||
| Efficacy Data | Tumor Growth Inhibition value (TGI) |
51.00%
|
High CD37 expression (CD37+++; CD37 MFI ratio=300) | ||
| Method Description |
The in vivo antitumor activity of AGS-67E was evaluated in a CD37 positive NHL,CLL and AmL cell line xenograft models. Depending on the cell line,110e6 cells were injected into the flanks of individual SCID mice,and tumor volumes were allowed to reach 100 to 300 mm3. Animals and their tumors were size matched and randomized into treatment and control groups. Depending on the study,AGS67E and an isotype control ADC were dosed by i.v. bolus injection either at 0.25,0.75,1.5,or 3.0 mg/kg at biweekly (BIW) or weekly (QW) frequencies and for a total of 2 to 4 doses.
Click to Show/Hide
|
||||
| In Vivo Model | CD37-expressing Mino MCL cancer xenograft model | ||||
| In Vitro Model | Mantle cell lymphoma | Mino cells | CVCL_1872 | ||
| Experiment 6 Reporting the Activity Date of This ADC | [3] | ||||
| Efficacy Data | Tumor Growth Inhibition value (TGI) |
63.00%
|
Moderate CD37 expression (CD37++; CD37 MFI ratio=140) | ||
| Method Description |
The in vivo antitumor activity of AGS-67E was evaluated in a CD37 positive NHL,CLL and AmL cell line xenograft models. Depending on the cell line,110e6 cells were injected into the flanks of individual SCID mice,and tumor volumes were allowed to reach 100 to 300 mm3. Animals and their tumors were size matched and randomized into treatment and control groups. Depending on the study,AGS67E and an isotype control ADC were dosed by i.v. bolus injection either at 0.25,0.75,1.5,or 3.0 mg/kg at biweekly (BIW) or weekly (QW) frequencies and for a total of 2 to 4 doses.
Click to Show/Hide
|
||||
| In Vivo Model | CD37-expressing Ramos-RR-XcL Burkitt lymphoma cancer xenograft model | ||||
| In Vitro Model | Burkitt lymphoma | Ramos cells | CVCL_0597 | ||
| Experiment 7 Reporting the Activity Date of This ADC | [3] | ||||
| Efficacy Data | Tumor Growth Inhibition value (TGI) |
66.00%
|
High CD37 expression (CD37+++; CD37 MFI ratio=580) | ||
| Method Description |
The in vivo antitumor activity of AGS-67E was evaluated in a CD37 positive NHL,CLL and AmL cell line xenograft models. Depending on the cell line,110e6 cells were injected into the flanks of individual SCID mice,and tumor volumes were allowed to reach 100 to 300 mm3. Animals and their tumors were size matched and randomized into treatment and control groups. Depending on the study,AGS67E and an isotype control ADC were dosed by i.v. bolus injection either at 0.25,0.75,1.5,or 3.0 mg/kg at biweekly (BIW) or weekly (QW) frequencies and for a total of 2 to 4 doses.
Click to Show/Hide
|
||||
| In Vivo Model | CD37-expressing DOHH2 FL cancer xenograft model | ||||
| In Vitro Model | Diffuse large B-cell lymphoma germinal center B-cell type | DoHH2 cells | CVCL_1179 | ||
| Experiment 8 Reporting the Activity Date of This ADC | [3] | ||||
| Efficacy Data | Tumor Growth Inhibition value (TGI) |
69.00%
|
Low CD37 expression (CD37+; CD37 MFI ratio=25) | ||
| Method Description |
The in vivo antitumor activity of AGS-67E was evaluated in a CD37 positive NHL,CLL and AmL cell line xenograft models. Depending on the cell line,110e6 cells were injected into the flanks of individual SCID mice,and tumor volumes were allowed to reach 100 to 300 mm3. Animals and their tumors were size matched and randomized into treatment and control groups. Depending on the study,AGS67E and an isotype control ADC were dosed by i.v. bolus injection either at 0.25,0.75,1.5,or 3.0 mg/kg at biweekly (BIW) or weekly (QW) frequencies and for a total of 2 to 4 doses.
Click to Show/Hide
|
||||
| In Vivo Model | CD37-expressing MOLM-13 AmL cancer xenograft model | ||||
| In Vitro Model | Adult acute myeloid leukemia | MOLM-13 cells | CVCL_2119 | ||
| Experiment 9 Reporting the Activity Date of This ADC | [3] | ||||
| Efficacy Data | Tumor Growth Inhibition value (TGI) |
86.00%
|
Moderate CD37 expression (CD37++; CD37 MFI ratio=140) | ||
| Method Description |
The in vivo antitumor activity of AGS-67E was evaluated in a CD37 positive NHL,CLL and AmL cell line xenograft models. Depending on the cell line,110e6 cells were injected into the flanks of individual SCID mice,and tumor volumes were allowed to reach 100 to 300 mm3. Animals and their tumors were size matched and randomized into treatment and control groups. Depending on the study,AGS67E and an isotype control ADC were dosed by i.v. bolus injection either at 0.25,0.75,1.5,or 3.0 mg/kg at biweekly (BIW) or weekly (QW) frequencies and for a total of 2 to 4 doses.
Click to Show/Hide
|
||||
| In Vivo Model | CD37-expressing Ramos-RR-XcL Burkitt lymphoma cancer xenograft model | ||||
| In Vitro Model | Burkitt lymphoma | Ramos cells | CVCL_0597 | ||
| Experiment 10 Reporting the Activity Date of This ADC | [3] | ||||
| Efficacy Data | Tumor Growth Inhibition value (TGI) |
92.00%
|
High CD37 expression (CD37+++; CD37 MFI ratio=300) | ||
| Method Description |
The in vivo antitumor activity of AGS-67E was evaluated in a CD37 positive NHL,CLL and AmL cell line xenograft models. Depending on the cell line,110e6 cells were injected into the flanks of individual SCID mice,and tumor volumes were allowed to reach 100 to 300 mm3. Animals and their tumors were size matched and randomized into treatment and control groups. Depending on the study,AGS67E and an isotype control ADC were dosed by i.v. bolus injection either at 0.25,0.75,1.5,or 3.0 mg/kg at biweekly (BIW) or weekly (QW) frequencies and for a total of 2 to 4 doses.
Click to Show/Hide
|
||||
| In Vivo Model | CD37-expressing Mino MCL cancer xenograft model | ||||
| In Vitro Model | Mantle cell lymphoma | Mino cells | CVCL_1872 | ||
| Experiment 11 Reporting the Activity Date of This ADC | [3] | ||||
| Efficacy Data | Tumor Growth Inhibition value (TGI) |
95.00%
|
High CD37 expression (CD37+++; CD37 MFI ratio=580) | ||
| Method Description |
The in vivo antitumor activity of AGS-67E was evaluated in a CD37 positive NHL,CLL and AmL cell line xenograft models. Depending on the cell line,110e6 cells were injected into the flanks of individual SCID mice,and tumor volumes were allowed to reach 100 to 300 mm3. Animals and their tumors were size matched and randomized into treatment and control groups. Depending on the study,AGS67E and an isotype control ADC were dosed by i.v. bolus injection either at 0.25,0.75,1.5,or 3.0 mg/kg at biweekly (BIW) or weekly (QW) frequencies and for a total of 2 to 4 doses.
Click to Show/Hide
|
||||
| In Vivo Model | CD37-expressing DOHH2 FL cancer xenograft model | ||||
| In Vitro Model | Diffuse large B-cell lymphoma germinal center B-cell type | DoHH2 cells | CVCL_1179 | ||
| Experiment 12 Reporting the Activity Date of This ADC | [3] | ||||
| Efficacy Data | Tumor Growth Inhibition value (TGI) |
95.00%
|
Low CD37 expression (CD37+; CD37 MFI ratio=23) | ||
| Method Description |
The in vivo antitumor activity of AGS-67E was evaluated in a CD37 positive NHL,CLL and AmL cell line xenograft models. Depending on the cell line,110e6 cells were injected into the flanks of individual SCID mice,and tumor volumes were allowed to reach 100 to 300 mm3. Animals and their tumors were size matched and randomized into treatment and control groups. Depending on the study,AGS67E and an isotype control ADC were dosed by i.v. bolus injection either at 0.25,0.75,1.5,or 3.0 mg/kg at biweekly (BIW) or weekly (QW) frequencies and for a total of 2 to 4 doses.
Click to Show/Hide
|
||||
| In Vivo Model | CD37-expressing THP-1 AmL cancer xenograft models | ||||
| In Vitro Model | Childhood acute monocytic leukemia | THP-1 cells | CVCL_0006 | ||
| Experiment 13 Reporting the Activity Date of This ADC | [3] | ||||
| Efficacy Data | Tumor Growth Inhibition value (TGI) |
96.00%
|
High CD37 expression (CD37+++; CD37 MFI ratio=554) | ||
| Method Description |
The in vivo antitumor activity of AGS-67E was evaluated in a CD37 positive NHL,CLL and AmL cell line xenograft models. Depending on the cell line,110e6 cells were injected into the flanks of individual SCID mice,and tumor volumes were allowed to reach 100 to 300 mm3. Animals and their tumors were size matched and randomized into treatment and control groups. Depending on the study,AGS67E and an isotype control ADC were dosed by i.v. bolus injection either at 0.25,0.75,1.5,or 3.0 mg/kg at biweekly (BIW) or weekly (QW) frequencies and for a total of 2 to 4 doses.
Click to Show/Hide
|
||||
| In Vivo Model | CD37-expressing WSU-DLCL2 DBCL cancer xenograft model | ||||
| In Vitro Model | Diffuse large B-cell lymphoma | WSU-DLCL2 cells | CVCL_1902 | ||
| Experiment 14 Reporting the Activity Date of This ADC | [3] | ||||
| Efficacy Data | Tumor Growth Inhibition value (TGI) |
97.00%
|
Moderate CD37 expression (CD37++; CD37 MFI ratio=140) | ||
| Method Description |
The in vivo antitumor activity of AGS-67E was evaluated in a CD37 positive NHL,CLL and AmL cell line xenograft models. Depending on the cell line,110e6 cells were injected into the flanks of individual SCID mice,and tumor volumes were allowed to reach 100 to 300 mm3. Animals and their tumors were size matched and randomized into treatment and control groups. Depending on the study,AGS67E and an isotype control ADC were dosed by i.v. bolus injection either at 0.25,0.75,1.5,or 3.0 mg/kg at biweekly (BIW) or weekly (QW) frequencies and for a total of 2 to 4 doses.
Click to Show/Hide
|
||||
| In Vivo Model | CD37-expressing Ramos-RR-XcL Burkitt lymphoma cancer xenograft model | ||||
| In Vitro Model | Burkitt lymphoma | Ramos cells | CVCL_0597 | ||
| Experiment 15 Reporting the Activity Date of This ADC | [3] | ||||
| Efficacy Data | Tumor Growth Inhibition value (TGI) |
100.00%
|
Moderate CD37 expression (CD37++; CD37 MFI ratio=129) | ||
| Method Description |
The in vivo antitumor activity of AGS-67E was evaluated in a CD37 positive NHL,CLL and AmL cell line xenograft models. Depending on the cell line,110e6 cells were injected into the flanks of individual SCID mice,and tumor volumes were allowed to reach 100 to 300 mm3. Animals and their tumors were size matched and randomized into treatment and control groups. Depending on the study,AGS67E and an isotype control ADC were dosed by i.v. bolus injection either at 0.25,0.75,1.5,or 3.0 mg/kg at biweekly (BIW) or weekly (QW) frequencies and for a total of 2 to 4 doses.
Click to Show/Hide
|
||||
| In Vivo Model | CD38-expressing JVM3 xenograft CLL cancer model | ||||
| In Vitro Model | B-cell prolymphocytic leukemia | JVM-3 cells | CVCL_1320 | ||
| Experiment 16 Reporting the Activity Date of This ADC | [3] | ||||
| Efficacy Data | Tumor Growth Inhibition value (TGI) |
100.00%
|
Moderate CD37 expression (CD37++; CD37 MFI ratio=129) | ||
| Method Description |
The in vivo antitumor activity of AGS-67E was evaluated in a CD37 positive NHL,CLL and AmL cell line xenograft models. Depending on the cell line,110e6 cells were injected into the flanks of individual SCID mice,and tumor volumes were allowed to reach 100 to 300 mm3. Animals and their tumors were size matched and randomized into treatment and control groups. Depending on the study,AGS67E and an isotype control ADC were dosed by i.v. bolus injection either at 0.25,0.75,1.5,or 3.0 mg/kg at biweekly (BIW) or weekly (QW) frequencies and for a total of 2 to 4 doses.
Click to Show/Hide
|
||||
| In Vivo Model | CD38-expressing JVM3 xenograft CLL cancer model | ||||
| In Vitro Model | B-cell prolymphocytic leukemia | JVM-3 cells | CVCL_1320 | ||
| Experiment 17 Reporting the Activity Date of This ADC | [3] | ||||
| Efficacy Data | Tumor Growth Inhibition value (TGI) |
100.00%
|
Moderate CD37 expression (CD37++; CD37 MFI ratio=129) | ||
| Method Description |
The in vivo antitumor activity of AGS-67E was evaluated in a CD37 positive NHL,CLL and AmL cell line xenograft models. Depending on the cell line,110e6 cells were injected into the flanks of individual SCID mice,and tumor volumes were allowed to reach 100 to 300 mm3. Animals and their tumors were size matched and randomized into treatment and control groups. Depending on the study,AGS67E and an isotype control ADC were dosed by i.v. bolus injection either at 0.25,0.75,1.5,or 3.0 mg/kg at biweekly (BIW) or weekly (QW) frequencies and for a total of 2 to 4 doses.
Click to Show/Hide
|
||||
| In Vivo Model | CD38-expressing JVM3 xenograft CLL cancer model | ||||
| In Vitro Model | B-cell prolymphocytic leukemia | JVM-3 cells | CVCL_1320 | ||
| Experiment 18 Reporting the Activity Date of This ADC | [3] | ||||
| Efficacy Data | Tumor Growth Inhibition value (TGI) |
100.00%
|
Low CD37 expression (CD37+; CD37 MFI ratio=22) | ||
| Method Description |
The in vivo antitumor activity of AGS-67E was evaluated in a CD37 positive NHL,CLL and AmL cell line xenograft models. Depending on the cell line,110e6 cells were injected into the flanks of individual SCID mice,and tumor volumes were allowed to reach 100 to 300 mm3. Animals and their tumors were size matched and randomized into treatment and control groups. Depending on the study,AGS67E and an isotype control ADC were dosed by i.v. bolus injection either at 0.25,0.75,1.5,or 3.0 mg/kg at biweekly (BIW) or weekly (QW) frequencies and for a total of 2 to 4 doses.
Click to Show/Hide
|
||||
| In Vivo Model | CD38-expressing MV-411 AmL cancer xenograft model | ||||
| In Vitro Model | Childhood acute monocytic leukemia | MV4-11 cells | CVCL_0064 | ||
| Experiment 19 Reporting the Activity Date of This ADC | [3] | ||||
| Efficacy Data | Tumor Growth Inhibition value (TGI) |
100.00%
|
Low CD37 expression (CD37+; CD37 MFI ratio=22) | ||
| Method Description |
The in vivo antitumor activity of AGS-67E was evaluated in a CD37 positive NHL,CLL and AmL cell line xenograft models. Depending on the cell line,110e6 cells were injected into the flanks of individual SCID mice,and tumor volumes were allowed to reach 100 to 300 mm3. Animals and their tumors were size matched and randomized into treatment and control groups. Depending on the study,AGS67E and an isotype control ADC were dosed by i.v. bolus injection either at 0.25,0.75,1.5,or 3.0 mg/kg at biweekly (BIW) or weekly (QW) frequencies and for a total of 2 to 4 doses.
Click to Show/Hide
|
||||
| In Vivo Model | CD38-expressing MV-411 AmL cancer xenograft model | ||||
| In Vitro Model | Childhood acute monocytic leukemia | MV4-11 cells | CVCL_0064 | ||
| Experiment 20 Reporting the Activity Date of This ADC | [3] | ||||
| Efficacy Data | Tumor Growth Inhibition value (TGI) |
100.00%
|
Low CD37 expression (CD37+; CD37 MFI ratio=22) | ||
| Method Description |
The in vivo antitumor activity of AGS-67E was evaluated in a CD37 positive NHL,CLL and AmL cell line xenograft models. Depending on the cell line,110e6 cells were injected into the flanks of individual SCID mice,and tumor volumes were allowed to reach 100 to 300 mm3. Animals and their tumors were size matched and randomized into treatment and control groups. Depending on the study,AGS67E and an isotype control ADC were dosed by i.v. bolus injection either at 0.25,0.75,1.5,or 3.0 mg/kg at biweekly (BIW) or weekly (QW) frequencies and for a total of 2 to 4 doses.
Click to Show/Hide
|
||||
| In Vivo Model | CD38-expressing MV-411 AmL cancer xenograft model | ||||
| In Vitro Model | Childhood acute monocytic leukemia | MV4-11 cells | CVCL_0064 | ||
| Experiment 21 Reporting the Activity Date of This ADC | [3] | ||||
| Efficacy Data | Tumor Growth Inhibition value (TGI) |
100.00%
|
Low CD37 expression (CD37+; CD37 MFI ratio=25) | ||
| Method Description |
The in vivo antitumor activity of AGS-67E was evaluated in a CD37 positive NHL,CLL and AmL cell line xenograft models. Depending on the cell line,110e6 cells were injected into the flanks of individual SCID mice,and tumor volumes were allowed to reach 100 to 300 mm3. Animals and their tumors were size matched and randomized into treatment and control groups. Depending on the study,AGS67E and an isotype control ADC were dosed by i.v. bolus injection either at 0.25,0.75,1.5,or 3.0 mg/kg at biweekly (BIW) or weekly (QW) frequencies and for a total of 2 to 4 doses.
Click to Show/Hide
|
||||
| In Vivo Model | CD37-expressing MOLM-13 AmL cancer xenograft model | ||||
| In Vitro Model | Adult acute myeloid leukemia | MOLM-13 cells | CVCL_2119 | ||
| Experiment 22 Reporting the Activity Date of This ADC | [3] | ||||
| Efficacy Data | Tumor Growth Inhibition value (TGI) |
100.00%
|
Low CD37 expression (CD37+; CD37 MFI ratio=25) | ||
| Method Description |
The in vivo antitumor activity of AGS-67E was evaluated in a CD37 positive NHL,CLL and AmL cell line xenograft models. Depending on the cell line,110e6 cells were injected into the flanks of individual SCID mice,and tumor volumes were allowed to reach 100 to 300 mm3. Animals and their tumors were size matched and randomized into treatment and control groups. Depending on the study,AGS67E and an isotype control ADC were dosed by i.v. bolus injection either at 0.25,0.75,1.5,or 3.0 mg/kg at biweekly (BIW) or weekly (QW) frequencies and for a total of 2 to 4 doses.
Click to Show/Hide
|
||||
| In Vivo Model | CD37-expressing MOLM-13 AmL cancer xenograft model | ||||
| In Vitro Model | Adult acute myeloid leukemia | MOLM-13 cells | CVCL_2119 | ||
Revealed Based on the Cell Line Data
| Experiment 1 Reporting the Activity Date of This ADC | [3] | ||||
| Efficacy Data | Half Maximal Inhibitory Concentration (IC50) |
0.05±0.03 nM
|
Low CD37 expression (CD37+; CD37 MFI ratio=25) | ||
| Method Description |
The inhibitory activity of AGS-67E against cancer cell growth was evaluated in various human cancer cell lines in vitro. Exponentially growing cells with a viability of 95% or greater were plated in fresh RPMI-1640 (Gibco-Invitrogen) media containing phenol red supplemented with 10% FBS (heat inactivated),10 mmol/L Hepes,and 1 mmol/L sodium pyruvate. Cells were left overnight and treated with AGS67E and an isotype control. After 5 days of treatment and incubation at 37°C and 5% CO2,cell viability was measured following a 1 hour incubation at 37°C with Presto Blue Reagent (Invitrogen).
Click to Show/Hide
|
||||
| In Vitro Model | Burkitt lymphoma | Ramos cells | CVCL_0597 | ||
| Experiment 2 Reporting the Activity Date of This ADC | [3] | ||||
| Efficacy Data | Half Maximal Inhibitory Concentration (IC50) |
0.07±0.49 nM
|
Low CD37 expression (CD37+; CD37 MFI ratio=18) | ||
| Method Description |
The inhibitory activity of AGS-67E against cancer cell growth was evaluated in various human cancer cell lines in vitro. Exponentially growing cells with a viability of 95% or greater were plated in fresh RPMI-1640 (Gibco-Invitrogen) media containing phenol red supplemented with 10% FBS (heat inactivated),10 mmol/L Hepes,and 1 mmol/L sodium pyruvate. Cells were left overnight and treated with AGS67E and an isotype control. After 5 days of treatment and incubation at 37°C and 5% CO2,cell viability was measured following a 1 hour incubation at 37°C with Presto Blue Reagent (Invitrogen).
Click to Show/Hide
|
||||
| In Vitro Model | Mantle cell lymphoma | Mino cells | CVCL_1872 | ||
| Experiment 3 Reporting the Activity Date of This ADC | [3] | ||||
| Efficacy Data | Half Maximal Inhibitory Concentration (IC50) |
0.08±0.02 nM
|
|||
| Method Description |
The inhibitory activity of AGS-67E against cancer cell growth was evaluated in various human cancer cell lines in vitro. Exponentially growing cells with a viability of 95% or greater were plated in fresh RPMI-1640 (Gibco-Invitrogen) media containing phenol red supplemented with 10% FBS (heat inactivated),10 mmol/L Hepes,and 1 mmol/L sodium pyruvate. Cells were left overnight and treated with AGS67E and an isotype control. After 5 days of treatment and incubation at 37°C and 5% CO2,cell viability was measured following a 1 hour incubation at 37°C with Presto Blue Reagent (Invitrogen).
Click to Show/Hide
|
||||
| In Vitro Model | Burkitt lymphoma | Daudi cells | CVCL_0008 | ||
| Experiment 4 Reporting the Activity Date of This ADC | [3] | ||||
| Efficacy Data | Half Maximal Inhibitory Concentration (IC50) |
0.08±0.61 nM
|
Negative CD37 expression (CD37-; CD37 MFI ratio=3) | ||
| Method Description |
The inhibitory activity of AGS-67E against cancer cell growth was evaluated in various human cancer cell lines in vitro. Exponentially growing cells with a viability of 95% or greater were plated in fresh RPMI-1640 (Gibco-Invitrogen) media containing phenol red supplemented with 10% FBS (heat inactivated),10 mmol/L Hepes,and 1 mmol/L sodium pyruvate. Cells were left overnight and treated with AGS67E and an isotype control. After 5 days of treatment and incubation at 37°C and 5% CO2,cell viability was measured following a 1 hour incubation at 37°C with Presto Blue Reagent (Invitrogen).
Click to Show/Hide
|
||||
| In Vitro Model | Mantle cell lymphoma | Granta-519 cells | CVCL_1818 | ||
| Experiment 5 Reporting the Activity Date of This ADC | [3] | ||||
| Efficacy Data | Half Maximal Inhibitory Concentration (IC50) |
0.13±0.08 nM
|
High CD37 expression (CD37+++; CD37 MFI ratio=662) | ||
| Method Description |
The inhibitory activity of AGS-67E against cancer cell growth was evaluated in various human cancer cell lines in vitro. Exponentially growing cells with a viability of 95% or greater were plated in fresh RPMI-1640 (Gibco-Invitrogen) media containing phenol red supplemented with 10% FBS (heat inactivated),10 mmol/L Hepes,and 1 mmol/L sodium pyruvate. Cells were left overnight and treated with AGS67E and an isotype control. After 5 days of treatment and incubation at 37°C and 5% CO2,cell viability was measured following a 1 hour incubation at 37°C with Presto Blue Reagent (Invitrogen).
Click to Show/Hide
|
||||
| In Vitro Model | Childhood acute monocytic leukemia | THP-1 cells | CVCL_0006 | ||
| Experiment 6 Reporting the Activity Date of This ADC | [3] | ||||
| Efficacy Data | Half Maximal Inhibitory Concentration (IC50) |
0.23±0.30 nM
|
High CD37 expression (CD37+++; CD37 MFI ratio=534) | ||
| Method Description |
The inhibitory activity of AGS-67E against cancer cell growth was evaluated in various human cancer cell lines in vitro. Exponentially growing cells with a viability of 95% or greater were plated in fresh RPMI-1640 (Gibco-Invitrogen) media containing phenol red supplemented with 10% FBS (heat inactivated),10 mmol/L Hepes,and 1 mmol/L sodium pyruvate. Cells were left overnight and treated with AGS67E and an isotype control. After 5 days of treatment and incubation at 37°C and 5% CO2,cell viability was measured following a 1 hour incubation at 37°C with Presto Blue Reagent (Invitrogen).
Click to Show/Hide
|
||||
| In Vitro Model | Diffuse large B-cell lymphoma | SU-DHL-4 cells | CVCL_0539 | ||
| Experiment 7 Reporting the Activity Date of This ADC | [3] | ||||
| Efficacy Data | Half Maximal Inhibitory Concentration (IC50) |
0.50±0.72 nM
|
High CD37 expression (CD37+++; CD37 MFI ratio=581) | ||
| Method Description |
The inhibitory activity of AGS-67E against cancer cell growth was evaluated in various human cancer cell lines in vitro. Exponentially growing cells with a viability of 95% or greater were plated in fresh RPMI-1640 (Gibco-Invitrogen) media containing phenol red supplemented with 10% FBS (heat inactivated),10 mmol/L Hepes,and 1 mmol/L sodium pyruvate. Cells were left overnight and treated with AGS67E and an isotype control. After 5 days of treatment and incubation at 37°C and 5% CO2,cell viability was measured following a 1 hour incubation at 37°C with Presto Blue Reagent (Invitrogen).
Click to Show/Hide
|
||||
| In Vitro Model | B-cell prolymphocytic leukemia | JVM-3 cells | CVCL_1320 | ||
| Experiment 8 Reporting the Activity Date of This ADC | [3] | ||||
| Efficacy Data | Half Maximal Inhibitory Concentration (IC50) |
0.71±0.20 nM
|
Low CD37 expression (CD37+; CD37 MFI ratio=22) | ||
| Method Description |
The inhibitory activity of AGS-67E against cancer cell growth was evaluated in various human cancer cell lines in vitro. Exponentially growing cells with a viability of 95% or greater were plated in fresh RPMI-1640 (Gibco-Invitrogen) media containing phenol red supplemented with 10% FBS (heat inactivated),10 mmol/L Hepes,and 1 mmol/L sodium pyruvate. Cells were left overnight and treated with AGS67E and an isotype control. After 5 days of treatment and incubation at 37°C and 5% CO2,cell viability was measured following a 1 hour incubation at 37°C with Presto Blue Reagent (Invitrogen).
Click to Show/Hide
|
||||
| In Vitro Model | Acute myeloid leukemia | SKM-1 cells | CVCL_0098 | ||
| Experiment 9 Reporting the Activity Date of This ADC | [3] | ||||
| Efficacy Data | Half Maximal Inhibitory Concentration (IC50) |
0.98±1.10 nM
|
Negative CD37 expression (CD37-; CD37 MFI ratio=9) | ||
| Method Description |
The inhibitory activity of AGS-67E against cancer cell growth was evaluated in various human cancer cell lines in vitro. Exponentially growing cells with a viability of 95% or greater were plated in fresh RPMI-1640 (Gibco-Invitrogen) media containing phenol red supplemented with 10% FBS (heat inactivated),10 mmol/L Hepes,and 1 mmol/L sodium pyruvate. Cells were left overnight and treated with AGS67E and an isotype control. After 5 days of treatment and incubation at 37°C and 5% CO2,cell viability was measured following a 1 hour incubation at 37°C with Presto Blue Reagent (Invitrogen).
Click to Show/Hide
|
||||
| In Vitro Model | Diffuse large B-cell lymphoma germinal center B-cell type | DoHH2 cells | CVCL_1179 | ||
| Experiment 10 Reporting the Activity Date of This ADC | [3] | ||||
| Efficacy Data | Half Maximal Inhibitory Concentration (IC50) |
1.10±0.60 nM
|
Moderate CD37 expression (CD37++; CD37 MFI ratio=129) | ||
| Method Description |
The inhibitory activity of AGS-67E against cancer cell growth was evaluated in various human cancer cell lines in vitro. Exponentially growing cells with a viability of 95% or greater were plated in fresh RPMI-1640 (Gibco-Invitrogen) media containing phenol red supplemented with 10% FBS (heat inactivated),10 mmol/L Hepes,and 1 mmol/L sodium pyruvate. Cells were left overnight and treated with AGS67E and an isotype control. After 5 days of treatment and incubation at 37°C and 5% CO2,cell viability was measured following a 1 hour incubation at 37°C with Presto Blue Reagent (Invitrogen).
Click to Show/Hide
|
||||
| In Vitro Model | Adult acute myeloid leukemia | OCI-AML-2 cells | CVCL_1619 | ||
| Experiment 11 Reporting the Activity Date of This ADC | [3] | ||||
| Efficacy Data | Half Maximal Inhibitory Concentration (IC50) |
1.20±0.90 nM
|
Negative CD37 expression (CD37-; CD37 MFI ratio=1) | ||
| Method Description |
The inhibitory activity of AGS-67E against cancer cell growth was evaluated in various human cancer cell lines in vitro. Exponentially growing cells with a viability of 95% or greater were plated in fresh RPMI-1640 (Gibco-Invitrogen) media containing phenol red supplemented with 10% FBS (heat inactivated),10 mmol/L Hepes,and 1 mmol/L sodium pyruvate. Cells were left overnight and treated with AGS67E and an isotype control. After 5 days of treatment and incubation at 37°C and 5% CO2,cell viability was measured following a 1 hour incubation at 37°C with Presto Blue Reagent (Invitrogen).
Click to Show/Hide
|
||||
| In Vitro Model | Childhood acute monocytic leukemia | MV4-11 cells | CVCL_0064 | ||
| Experiment 12 Reporting the Activity Date of This ADC | [3] | ||||
| Efficacy Data | Half Maximal Inhibitory Concentration (IC50) |
1.30±0.50 nM
|
Low CD37 expression (CD37+; CD37 MFI ratio=20) | ||
| Method Description |
The inhibitory activity of AGS-67E against cancer cell growth was evaluated in various human cancer cell lines in vitro. Exponentially growing cells with a viability of 95% or greater were plated in fresh RPMI-1640 (Gibco-Invitrogen) media containing phenol red supplemented with 10% FBS (heat inactivated),10 mmol/L Hepes,and 1 mmol/L sodium pyruvate. Cells were left overnight and treated with AGS67E and an isotype control. After 5 days of treatment and incubation at 37°C and 5% CO2,cell viability was measured following a 1 hour incubation at 37°C with Presto Blue Reagent (Invitrogen).
Click to Show/Hide
|
||||
| In Vitro Model | Adult acute myeloid leukemia | MOLM-13 cells | CVCL_2119 | ||
| Experiment 13 Reporting the Activity Date of This ADC | [3] | ||||
| Efficacy Data | Half Maximal Inhibitory Concentration (IC50) |
3.50±0.70 nM
|
Low CD37 expression (CD37+; CD37 MFI ratio=11) | ||
| Method Description |
The inhibitory activity of AGS-67E against cancer cell growth was evaluated in various human cancer cell lines in vitro. Exponentially growing cells with a viability of 95% or greater were plated in fresh RPMI-1640 (Gibco-Invitrogen) media containing phenol red supplemented with 10% FBS (heat inactivated),10 mmol/L Hepes,and 1 mmol/L sodium pyruvate. Cells were left overnight and treated with AGS67E and an isotype control. After 5 days of treatment and incubation at 37°C and 5% CO2,cell viability was measured following a 1 hour incubation at 37°C with Presto Blue Reagent (Invitrogen).
Click to Show/Hide
|
||||
| In Vitro Model | Myeloid leukemia with maturation | Kasumi-1 cells | CVCL_0589 | ||
| Experiment 14 Reporting the Activity Date of This ADC | [3] | ||||
| Efficacy Data | Half Maximal Inhibitory Concentration (IC50) |
5.70±1.60 nM
|
Low CD37 expression (CD37+; CD37 MFI ratio=26) | ||
| Method Description |
The inhibitory activity of AGS-67E against cancer cell growth was evaluated in various human cancer cell lines in vitro. Exponentially growing cells with a viability of 95% or greater were plated in fresh RPMI-1640 (Gibco-Invitrogen) media containing phenol red supplemented with 10% FBS (heat inactivated),10 mmol/L Hepes,and 1 mmol/L sodium pyruvate. Cells were left overnight and treated with AGS67E and an isotype control. After 5 days of treatment and incubation at 37°C and 5% CO2,cell viability was measured following a 1 hour incubation at 37°C with Presto Blue Reagent (Invitrogen).
Click to Show/Hide
|
||||
| In Vitro Model | Acute myeloid leukemia | BDCM cells | CVCL_4613 | ||
| Experiment 15 Reporting the Activity Date of This ADC | [3] | ||||
| Efficacy Data | Half Maximal Inhibitory Concentration (IC50) |
19.70±3.00 nM
|
High CD37 expression (CD37+++; CD37 MFI ratio=341) | ||
| Method Description |
The inhibitory activity of AGS-67E against cancer cell growth was evaluated in various human cancer cell lines in vitro. Exponentially growing cells with a viability of 95% or greater were plated in fresh RPMI-1640 (Gibco-Invitrogen) media containing phenol red supplemented with 10% FBS (heat inactivated),10 mmol/L Hepes,and 1 mmol/L sodium pyruvate. Cells were left overnight and treated with AGS67E and an isotype control. After 5 days of treatment and incubation at 37°C and 5% CO2,cell viability was measured following a 1 hour incubation at 37°C with Presto Blue Reagent (Invitrogen).
Click to Show/Hide
|
||||
| In Vitro Model | Diffuse large B-cell lymphoma | WSU-DLCL2 cells | CVCL_1902 | ||
| Experiment 16 Reporting the Activity Date of This ADC | [3] | ||||
| Efficacy Data | Half Maximal Inhibitory Concentration (IC50) | > 10.00 uM | High CD37 expression (CD37+++; CD37 MFI ratio=301) | ||
| Method Description |
The inhibitory activity of AGS-67E against cancer cell growth was evaluated in various human cancer cell lines in vitro. Exponentially growing cells with a viability of 95% or greater were plated in fresh RPMI-1640 (Gibco-Invitrogen) media containing phenol red supplemented with 10% FBS (heat inactivated),10 mmol/L Hepes,and 1 mmol/L sodium pyruvate. Cells were left overnight and treated with AGS67E and an isotype control. After 5 days of treatment and incubation at 37°C and 5% CO2,cell viability was measured following a 1 hour incubation at 37°C with Presto Blue Reagent (Invitrogen).
Click to Show/Hide
|
||||
| In Vitro Model | Mantle cell lymphoma | REC-1 cells | CVCL_1884 | ||
| Experiment 17 Reporting the Activity Date of This ADC | [3] | ||||
| Efficacy Data | Half Maximal Inhibitory Concentration (IC50) | > 10.00 uM | High CD37 expression (CD37+++; CD37 MFI ratio=554) | ||
| Method Description |
The inhibitory activity of AGS-67E against cancer cell growth was evaluated in various human cancer cell lines in vitro. Exponentially growing cells with a viability of 95% or greater were plated in fresh RPMI-1640 (Gibco-Invitrogen) media containing phenol red supplemented with 10% FBS (heat inactivated),10 mmol/L Hepes,and 1 mmol/L sodium pyruvate. Cells were left overnight and treated with AGS67E and an isotype control. After 5 days of treatment and incubation at 37°C and 5% CO2,cell viability was measured following a 1 hour incubation at 37°C with Presto Blue Reagent (Invitrogen).
Click to Show/Hide
|
||||
| In Vitro Model | Acute myeloid leukemia | PL-21 cells | CVCL_2161 | ||
| Experiment 18 Reporting the Activity Date of This ADC | [3] | ||||
| Efficacy Data | Half Maximal Inhibitory Concentration (IC50) | > 10.00 uM | Low CD37 expression (CD37+; CD37 MFI ratio=39) | ||
| Method Description |
The inhibitory activity of AGS-67E against cancer cell growth was evaluated in various human cancer cell lines in vitro. Exponentially growing cells with a viability of 95% or greater were plated in fresh RPMI-1640 (Gibco-Invitrogen) media containing phenol red supplemented with 10% FBS (heat inactivated),10 mmol/L Hepes,and 1 mmol/L sodium pyruvate. Cells were left overnight and treated with AGS67E and an isotype control. After 5 days of treatment and incubation at 37°C and 5% CO2,cell viability was measured following a 1 hour incubation at 37°C with Presto Blue Reagent (Invitrogen).
Click to Show/Hide
|
||||
| In Vitro Model | Chronic eosinophilic leukemia | EoL-1 cells | CVCL_0258 | ||
| Experiment 19 Reporting the Activity Date of This ADC | [3] | ||||
| Efficacy Data | Half Maximal Inhibitory Concentration (IC50) | > 10.00 uM | High CD37 expression (CD37+++; CD37 MFI ratio=372) | ||
| Method Description |
The inhibitory activity of AGS-67E against cancer cell growth was evaluated in various human cancer cell lines in vitro. Exponentially growing cells with a viability of 95% or greater were plated in fresh RPMI-1640 (Gibco-Invitrogen) media containing phenol red supplemented with 10% FBS (heat inactivated),10 mmol/L Hepes,and 1 mmol/L sodium pyruvate. Cells were left overnight and treated with AGS67E and an isotype control. After 5 days of treatment and incubation at 37°C and 5% CO2,cell viability was measured following a 1 hour incubation at 37°C with Presto Blue Reagent (Invitrogen).
Click to Show/Hide
|
||||
| In Vitro Model | Adult acute myeloid leukemia | HL-60 cells | CVCL_0002 | ||
| Experiment 20 Reporting the Activity Date of This ADC | [3] | ||||
| Efficacy Data | Half Maximal Inhibitory Concentration (IC50) | > 10.00 uM | Negative CD37 expression (CD37-; CD37 MFI ratio=4) | ||
| Method Description |
The inhibitory activity of AGS-67E against cancer cell growth was evaluated in various human cancer cell lines in vitro. Exponentially growing cells with a viability of 95% or greater were plated in fresh RPMI-1640 (Gibco-Invitrogen) media containing phenol red supplemented with 10% FBS (heat inactivated),10 mmol/L Hepes,and 1 mmol/L sodium pyruvate. Cells were left overnight and treated with AGS67E and an isotype control. After 5 days of treatment and incubation at 37°C and 5% CO2,cell viability was measured following a 1 hour incubation at 37°C with Presto Blue Reagent (Invitrogen).
Click to Show/Hide
|
||||
| In Vitro Model | Adult acute megakaryoblastic leukemia | UT-7 cells | CVCL_2233 | ||
| Experiment 21 Reporting the Activity Date of This ADC | [3] | ||||
| Efficacy Data | Half Maximal Inhibitory Concentration (IC50) | > 10.00 uM | Negative CD37 expression (CD37-; CD37 MFI ratio=5) | ||
| Method Description |
The inhibitory activity of AGS-67E against cancer cell growth was evaluated in various human cancer cell lines in vitro. Exponentially growing cells with a viability of 95% or greater were plated in fresh RPMI-1640 (Gibco-Invitrogen) media containing phenol red supplemented with 10% FBS (heat inactivated),10 mmol/L Hepes,and 1 mmol/L sodium pyruvate. Cells were left overnight and treated with AGS67E and an isotype control. After 5 days of treatment and incubation at 37°C and 5% CO2,cell viability was measured following a 1 hour incubation at 37°C with Presto Blue Reagent (Invitrogen).
Click to Show/Hide
|
||||
| In Vitro Model | Adult acute myeloid leukemia | KG-1 cells | CVCL_0374 | ||
| Experiment 22 Reporting the Activity Date of This ADC | [3] | ||||
| Efficacy Data | Half Maximal Inhibitory Concentration (IC50) | > 10.00 uM | Low CD37 expression (CD37+; CD37 MFI ratio=30) | ||
| Method Description |
The inhibitory activity of AGS-67E against cancer cell growth was evaluated in various human cancer cell lines in vitro. Exponentially growing cells with a viability of 95% or greater were plated in fresh RPMI-1640 (Gibco-Invitrogen) media containing phenol red supplemented with 10% FBS (heat inactivated),10 mmol/L Hepes,and 1 mmol/L sodium pyruvate. Cells were left overnight and treated with AGS67E and an isotype control. After 5 days of treatment and incubation at 37°C and 5% CO2,cell viability was measured following a 1 hour incubation at 37°C with Presto Blue Reagent (Invitrogen).
Click to Show/Hide
|
||||
| In Vitro Model | Down syndrome | CMK cells | CVCL_0216 | ||
| Experiment 23 Reporting the Activity Date of This ADC | [3] | ||||
| Efficacy Data | Half Maximal Inhibitory Concentration (IC50) | > 10.00 uM | Low CD37 expression (CD37+; CD37 MFI ratio=10) | ||
| Method Description |
The inhibitory activity of AGS-67E against cancer cell growth was evaluated in various human cancer cell lines in vitro. Exponentially growing cells with a viability of 95% or greater were plated in fresh RPMI-1640 (Gibco-Invitrogen) media containing phenol red supplemented with 10% FBS (heat inactivated),10 mmol/L Hepes,and 1 mmol/L sodium pyruvate. Cells were left overnight and treated with AGS67E and an isotype control. After 5 days of treatment and incubation at 37°C and 5% CO2,cell viability was measured following a 1 hour incubation at 37°C with Presto Blue Reagent (Invitrogen).
Click to Show/Hide
|
||||
| In Vitro Model | Acute erythroid leukemia | TF-1a cells | CVCL_3608 | ||
| Experiment 24 Reporting the Activity Date of This ADC | [3] | ||||
| Efficacy Data | Half Maximal Inhibitory Concentration (IC50) | > 10.00 uM | Low CD37 expression (CD37+; CD37 MFI ratio=64) | ||
| Method Description |
The inhibitory activity of AGS-67E against cancer cell growth was evaluated in various human cancer cell lines in vitro. Exponentially growing cells with a viability of 95% or greater were plated in fresh RPMI-1640 (Gibco-Invitrogen) media containing phenol red supplemented with 10% FBS (heat inactivated),10 mmol/L Hepes,and 1 mmol/L sodium pyruvate. Cells were left overnight and treated with AGS67E and an isotype control. After 5 days of treatment and incubation at 37°C and 5% CO2,cell viability was measured following a 1 hour incubation at 37°C with Presto Blue Reagent (Invitrogen).
Click to Show/Hide
|
||||
| In Vitro Model | Acute erythroid leukemia | HEL 92.1 cells | CVCL_2481 | ||
| Experiment 25 Reporting the Activity Date of This ADC | [3] | ||||
| Efficacy Data | Half Maximal Inhibitory Concentration (IC50) | > 10.00 uM | Low CD37 expression (CD37+; CD37 MFI ratio=23) | ||
| Method Description |
The inhibitory activity of AGS-67E against cancer cell growth was evaluated in various human cancer cell lines in vitro. Exponentially growing cells with a viability of 95% or greater were plated in fresh RPMI-1640 (Gibco-Invitrogen) media containing phenol red supplemented with 10% FBS (heat inactivated),10 mmol/L Hepes,and 1 mmol/L sodium pyruvate. Cells were left overnight and treated with AGS67E and an isotype control. After 5 days of treatment and incubation at 37°C and 5% CO2,cell viability was measured following a 1 hour incubation at 37°C with Presto Blue Reagent (Invitrogen).
Click to Show/Hide
|
||||
| In Vitro Model | Adult T acute lymphoblastic leukemia | MOLT-4 cells | CVCL_0013 | ||
References
