Antibody Information
General Information of This Antibody (ID: ANI0FQGHG)
| Antibody Name | Depatuxizumab S238C |
|||||
|---|---|---|---|---|---|---|
| Antibody Type | Monoclonal antibody (mAb) |
|||||
| Antibody Subtype | Chimeric IgG1-kappa |
|||||
| Antigen Name | Epidermal growth factor receptor (EGFR) |
Antigen Info | ||||
| Click to Show/Hide the Sequence Information of This Antibody | ||||||
| Heavy Chain Sequence |
QVQLQESGPGLVKPSQTLSLTCTVSGYSISSDFAWNWIRQPPGKGLEWMGYISYSGNTRY
QPSLKSRITISRDTSKNQFFLKLNSVTAADTATYYCVTAGRGFPYWGQGTLVTVSSASTK GPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYS LSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPCVF LFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYR VVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKN QVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGN VFSCSVMHEALHNHYTQKSLSLSPGK Click to Show/Hide
|
|||||
| Light Chain Sequence |
DIQMTQSPSSMSVSVGDRVTITCHSSQDINSNIGWLQQKPGKSFKGLIYHGTNLDDGVPS
RFSGSGSGTDYTLTISSLQPEDFATYYCVQYAQFPWTFGGGTKLEIKRTVAAPSVFIFPP SDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLT LSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC Click to Show/Hide
|
|||||
Each Antibody-drug Conjugate Related to This Antibody
Full Information of The Activity Data of The ADC(s) Related to This Antibody
ABBV-322 [Investigative]
Discovered Using Patient-derived Xenograft Model
| Experiment 1 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Tumor Growth Inhibition value (TGI) | ≈ 34.60% | Positive EGFR expression (EGFR+++/++) | ||
| Method Description |
For the PDX 14R091 and PDX MPM36 studies, mice received ABBV-322 (0.03 mg/kg) or control ADC (0.03 mg/kg) every 4 days, for a total of 12 treatments.
|
||||
| In Vivo Model | Malignant Mesothelioma PDX model (PDX: MPM36) | ||||
| Experiment 2 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Tumor Growth Inhibition value (TGI) | ≈ 65.80% | Positive EGFR expression (EGFR+++/++) | ||
| Method Description |
For the PDX 14R091 and PDX MPM36 studies, mice received ABBV-322 (0.03 mg/kg) or control ADC (0.03 mg/kg) every 4 days, for a total of 12 treatments.
|
||||
| In Vivo Model | Malignant Mesothelioma PDX model (PDX: 14R091) | ||||
Revealed Based on the Cell Line Data
| Experiment 1 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Half Maximal Inhibitory Concentration (IC50) |
10.00 - 35.00 ug/mL
|
Positive EGFR expression (EGFR+++/++) | ||
| Method Description |
Cells lines were plated at 1,000-3,000 cells per well in complete growth medium containing 10% FCS in 96-well plates and allowed to adhere overnight.
|
||||
| In Vitro Model | Pleural mesothelioma | NCI-H2052 cells | CVCL_1518 | ||
| Experiment 2 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Half Maximal Inhibitory Concentration (IC50) |
10.00 - 35.00 ug/mL
|
Positive EGFR expression (EGFR+++/++) | ||
| Method Description |
Cells lines were plated at 1,000-3,000 cells per well in complete growth medium containing 10% FCS in 96-well plates and allowed to adhere overnight.
|
||||
| In Vitro Model | Pleural mesothelioma | NCI-H2052 cells | CVCL_1518 | ||
| Experiment 3 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Half Maximal Inhibitory Concentration (IC50) |
10.00 - 35.00 ug/mL
|
Positive EGFR expression (EGFR+++/++) | ||
| Method Description |
Cells lines were plated at 1,000-3,000 cells per well in complete growth medium containing 10% FCS in 96-well plates and allowed to adhere overnight.
|
||||
| In Vitro Model | Pleural mesothelioma | NCI-H28 cells | CVCL_1555 | ||
| Experiment 4 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Half Maximal Inhibitory Concentration (IC50) |
10.00 - 35.00 ug/mL
|
Positive EGFR expression (EGFR+++/++) | ||
| Method Description |
Cells lines were plated at 1,000-3,000 cells per well in complete growth medium containing 10% FCS in 96-well plates and allowed to adhere overnight.
|
||||
| In Vitro Model | Pleural biphasic mesothelioma | MSTO-211H cells | CVCL_1430 | ||
References
