General Information of This Antibody (ID: ANI0EGRHN)
Antibody Name
HS627
Antibody Type
Monoclonal antibody (mAb)
Antibody Subtype
Humanized IgG1-kappa
Antigen Name
Receptor tyrosine-protein kinase erbB-2 (ERBB2)
 Antigen Info 
Click to Show/Hide the Sequence Information of This Antibody
Heavy Chain Sequence
EVQLVESGGGLVQPGGSLRLSCAASGFTFTDYTMDWVRQAPGKGLEWVADVNPNSGGSIY
NQRFKGRFTLSVDRSKNTLYLQMNSLRAEDTAVYYCARNLGPSFYFDYWGQGTLVTVSSA
STKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSG
LYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGP
SVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNS
TYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEM
TKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQ
QGNVFSCSVMHEALHNHYTQKSLSLSPGK
    Click to Show/Hide
Light Chain Sequence
DIQMTQSPSSLSASVGDRVTITCKASQDVSIGVAWYQQKPGKAPKLLIYSASYRYTGVPS
RFSGSGSGTDFTLTISSLQPEDFATYYCQQYYIYPYTFGQGTKVEIKRTVAAPSVFIFPP
SDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLT
LSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC
    Click to Show/Hide
Each Antibody-drug Conjugate Related to This Antibody
Full Information of The Activity Data of The ADC(s) Related to This Antibody
CN116785448A ADC2 [Investigative]
Revealed Based on the Cell Line Data
Click To Hide/Show 3 Activity Data Related to This Level
Experiment 1 Reporting the Activity Date of This ADC [1]
Efficacy Data Half Maximal inhibitory Concentration (lC50)
3.19 nM
Method Description
Human esophageal cancer cells OE33 were cultured in the medium until the exponential growth phase. After trypsin digestion, the cells were centrifuged and the supernatant was discarded. The medium was diluted to 3×104 cells/mL, 0.5×104 cells/mL and 1.5×104 cells/mL respectively. 100 uL of H100 was added to 96231 cells in RPMI 1640 (Cellmax), RPM11640 (Cellmax) and cell culture plates with 10% fetal bovine serum (Cellmax), and placed in a 37°C, 5% CO2 incubator for overnight culture. The next day, the ADC to be tested was diluted in the medium to 2000 nM, 400 nM, 80 nM, 16 nM, 3.2 nM, 0.64 nM, 0.128 nM, 0.026 nM, and 100 uL of the diluted ADC was added to each well of the 96-well cell culture plate. Three replicates were set for each concentration. The negative control and blank control groups without ADC were added 100 uL of the medium to each well. After the addition of the sample, the plate was returned to the 37°C, 5% CO2 incubator for further incubation for 6 days. After incubation, the cell culture plate was removed, and the medium in the plate was aspirated using a pipette. 100 uL of the medium containing 10% CCK-8 was added to each well, and incubated at 37°C for 3 hours. After incubation, the plate was removed, placed in an enzyme-linked plate, and selected 630 nm as the reference wavelength and 450 nm as the measurement wavelength to determine the absorbance. Based on the absorbance value, the IC50 was calculated using the four-parameter regression in GraphPad.

   Click to Show/Hide
In Vitro Model Barrett adenocarcinoma OE33 cells CVCL_0471
Experiment 2 Reporting the Activity Date of This ADC [1]
Efficacy Data Half Maximal inhibitory Concentration (lC50)
7.17 nM
Method Description
Breast cancer cells MDA-MBDMEM (Cellmax) were cultured in the medium until the exponential growth phase. After trypsin digestion, the cells were centrifuged and the supernatant was discarded. The medium was diluted to 3×104 cells/mL, 0.5×104 cells/mL and 1.5×104 cells/mL respectively. 100 uL of H100 was added to 96231 cells in RPMI 1640 (Cellmax), RPM11640 (Cellmax) and cell culture plates with 10% fetal bovine serum (Cellmax), and placed in a 37°C, 5% CO2 incubator for overnight culture. The next day, the ADC to be tested was diluted in the medium to 2000 nM, 400 nM, 80 nM, 16 nM, 3.2 nM, 0.64 nM, 0.128 nM, 0.026 nM, and 100 uL of the diluted ADC was added to each well of the 96-well cell culture plate. Three replicates were set for each concentration. The negative control and blank control groups without ADC were added 100 uL of the medium to each well. After the addition of the sample, the plate was returned to the 37°C, 5% CO2 incubator for further incubation for 6 days. After incubation, the cell culture plate was removed, and the medium in the plate was aspirated using a pipette. 100 uL of the medium containing 10% CCK-8 was added to each well, and incubated at 37°C for 3 hours. After incubation, the plate was removed, placed in an enzyme-linked plate, and selected 630 nm as the reference wavelength and 450 nm as the measurement wavelength to determine the absorbance. Based on the absorbance value, the IC50 was calculated using the four-parameter regression in GraphPad.

   Click to Show/Hide
In Vitro Model Breast adenocarcinoma MDA-MBDMEM cells CVCL_0062
Experiment 3 Reporting the Activity Date of This ADC [1]
Efficacy Data Half Maximal inhibitory Concentration (lC50)
8.03 nM
Method Description
Lung cancer cells NCI-H1975 were cultured in the medium until the exponential growth phase. After trypsin digestion, the cells were centrifuged and the supernatant was discarded. The medium was diluted to 3×104 cells/mL, 0.5×104 cells/mL and 1.5×104 cells/mL respectively. 100 uL of H100 was added to 96231 cells in RPMI 1640 (Cellmax), RPM11640 (Cellmax) and cell culture plates with 10% fetal bovine serum (Cellmax), and placed in a 37°C, 5% CO2 incubator for overnight culture. The next day, the ADC to be tested was diluted in the medium to 2000 nM, 400 nM, 80 nM, 16 nM, 3.2 nM, 0.64 nM, 0.128 nM, 0.026 nM, and 100 uL of the diluted ADC was added to each well of the 96-well cell culture plate. Three replicates were set for each concentration. The negative control and blank control groups without ADC were added 100 uL of the medium to each well. After the addition of the sample, the plate was returned to the 37°C, 5% CO2 incubator for further incubation for 6 days. After incubation, the cell culture plate was removed, and the medium in the plate was aspirated using a pipette. 100 uL of the medium containing 10% CCK-8 was added to each well, and incubated at 37°C for 3 hours. After incubation, the plate was removed, placed in an enzyme-linked plate, and selected 630 nm as the reference wavelength and 450 nm as the measurement wavelength to determine the absorbance. Based on the absorbance value, the IC50 was calculated using the four-parameter regression in GraphPad.

   Click to Show/Hide
In Vitro Model Lung adenocarcinoma NCI-H1975 cells CVCL_1511
CN116785448A ADC5 [Investigative]
Revealed Based on the Cell Line Data
Click To Hide/Show 3 Activity Data Related to This Level
Experiment 1 Reporting the Activity Date of This ADC [1]
Efficacy Data Half Maximal inhibitory Concentration (lC50)
3.84 nM
Method Description
Human esophageal cancer cells OE33 were cultured in the medium until the exponential growth phase. After trypsin digestion, the cells were centrifuged and the supernatant was discarded. The medium was diluted to 3×104 cells/mL, 0.5×104 cells/mL and 1.5×104 cells/mL respectively. 100 uL of H100 was added to 96231 cells in RPMI 1640 (Cellmax), RPM11640 (Cellmax) and cell culture plates with 10% fetal bovine serum (Cellmax), and placed in a 37°C, 5% CO2 incubator for overnight culture. The next day, the ADC to be tested was diluted in the medium to 2000 nM, 400 nM, 80 nM, 16 nM, 3.2 nM, 0.64 nM, 0.128 nM, 0.026 nM, and 100 uL of the diluted ADC was added to each well of the 96-well cell culture plate. Three replicates were set for each concentration. The negative control and blank control groups without ADC were added 100 uL of the medium to each well. After the addition of the sample, the plate was returned to the 37°C, 5% CO2 incubator for further incubation for 6 days. After incubation, the cell culture plate was removed, and the medium in the plate was aspirated using a pipette. 100 uL of the medium containing 10% CCK-8 was added to each well, and incubated at 37°C for 3 hours. After incubation, the plate was removed, placed in an enzyme-linked plate, and selected 630 nm as the reference wavelength and 450 nm as the measurement wavelength to determine the absorbance. Based on the absorbance value, the IC50 was calculated using the four-parameter regression in GraphPad.

   Click to Show/Hide
In Vitro Model Barrett adenocarcinoma OE33 cells CVCL_0471
Experiment 2 Reporting the Activity Date of This ADC [1]
Efficacy Data Half Maximal inhibitory Concentration (lC50)
5.91 nM
Method Description
Breast cancer cells MDA-MBDMEM (Cellmax) were cultured in the medium until the exponential growth phase. After trypsin digestion, the cells were centrifuged and the supernatant was discarded. The medium was diluted to 3×104 cells/mL, 0.5×104 cells/mL and 1.5×104 cells/mL respectively. 100 uL of H100 was added to 96231 cells in RPMI 1640 (Cellmax), RPM11640 (Cellmax) and cell culture plates with 10% fetal bovine serum (Cellmax), and placed in a 37°C, 5% CO2 incubator for overnight culture. The next day, the ADC to be tested was diluted in the medium to 2000 nM, 400 nM, 80 nM, 16 nM, 3.2 nM, 0.64 nM, 0.128 nM, 0.026 nM, and 100 uL of the diluted ADC was added to each well of the 96-well cell culture plate. Three replicates were set for each concentration. The negative control and blank control groups without ADC were added 100 uL of the medium to each well. After the addition of the sample, the plate was returned to the 37°C, 5% CO2 incubator for further incubation for 6 days. After incubation, the cell culture plate was removed, and the medium in the plate was aspirated using a pipette. 100 uL of the medium containing 10% CCK-8 was added to each well, and incubated at 37°C for 3 hours. After incubation, the plate was removed, placed in an enzyme-linked plate, and selected 630 nm as the reference wavelength and 450 nm as the measurement wavelength to determine the absorbance. Based on the absorbance value, the IC50 was calculated using the four-parameter regression in GraphPad.

   Click to Show/Hide
In Vitro Model Breast adenocarcinoma MDA-MBDMEM cells CVCL_0062
Experiment 3 Reporting the Activity Date of This ADC [1]
Efficacy Data Half Maximal inhibitory Concentration (lC50)
13.25 nM
Method Description
Lung cancer cells NCI-H1975 were cultured in the medium until the exponential growth phase. After trypsin digestion, the cells were centrifuged and the supernatant was discarded. The medium was diluted to 3×104 cells/mL, 0.5×104 cells/mL and 1.5×104 cells/mL respectively. 100 uL of H100 was added to 96231 cells in RPMI 1640 (Cellmax), RPM11640 (Cellmax) and cell culture plates with 10% fetal bovine serum (Cellmax), and placed in a 37°C, 5% CO2 incubator for overnight culture. The next day, the ADC to be tested was diluted in the medium to 2000 nM, 400 nM, 80 nM, 16 nM, 3.2 nM, 0.64 nM, 0.128 nM, 0.026 nM, and 100 uL of the diluted ADC was added to each well of the 96-well cell culture plate. Three replicates were set for each concentration. The negative control and blank control groups without ADC were added 100 uL of the medium to each well. After the addition of the sample, the plate was returned to the 37°C, 5% CO2 incubator for further incubation for 6 days. After incubation, the cell culture plate was removed, and the medium in the plate was aspirated using a pipette. 100 uL of the medium containing 10% CCK-8 was added to each well, and incubated at 37°C for 3 hours. After incubation, the plate was removed, placed in an enzyme-linked plate, and selected 630 nm as the reference wavelength and 450 nm as the measurement wavelength to determine the absorbance. Based on the absorbance value, the IC50 was calculated using the four-parameter regression in GraphPad.

   Click to Show/Hide
In Vitro Model Lung adenocarcinoma NCI-H1975 cells CVCL_1511
CN116785448A ADC1 [Investigative]
Revealed Based on the Cell Line Data
Click To Hide/Show 3 Activity Data Related to This Level
Experiment 1 Reporting the Activity Date of This ADC [1]
Efficacy Data Half Maximal inhibitory Concentration (lC50)
4.27 nM
Method Description
Breast cancer cells MDA-MBDMEM (Cellmax) were cultured in the medium until the exponential growth phase. After trypsin digestion, the cells were centrifuged and the supernatant was discarded. The medium was diluted to 3×104 cells/mL, 0.5×104 cells/mL and 1.5×104 cells/mL respectively. 100 uL of H100 was added to 96231 cells in RPMI 1640 (Cellmax), RPM11640 (Cellmax) and cell culture plates with 10% fetal bovine serum (Cellmax), and placed in a 37°C, 5% CO2 incubator for overnight culture. The next day, the ADC to be tested was diluted in the medium to 2000 nM, 400 nM, 80 nM, 16 nM, 3.2 nM, 0.64 nM, 0.128 nM, 0.026 nM, and 100 uL of the diluted ADC was added to each well of the 96-well cell culture plate. Three replicates were set for each concentration. The negative control and blank control groups without ADC were added 100 uL of the medium to each well. After the addition of the sample, the plate was returned to the 37°C, 5% CO2 incubator for further incubation for 6 days. After incubation, the cell culture plate was removed, and the medium in the plate was aspirated using a pipette. 100 uL of the medium containing 10% CCK-8 was added to each well, and incubated at 37°C for 3 hours. After incubation, the plate was removed, placed in an enzyme-linked plate, and selected 630 nm as the reference wavelength and 450 nm as the measurement wavelength to determine the absorbance. Based on the absorbance value, the IC50 was calculated using the four-parameter regression in GraphPad.

   Click to Show/Hide
In Vitro Model Breast adenocarcinoma MDA-MBDMEM cells CVCL_0062
Experiment 2 Reporting the Activity Date of This ADC [1]
Efficacy Data Half Maximal inhibitory Concentration (lC50)
6.04 nM
Method Description
Human esophageal cancer cells OE33 were cultured in the medium until the exponential growth phase. After trypsin digestion, the cells were centrifuged and the supernatant was discarded. The medium was diluted to 3×104 cells/mL, 0.5×104 cells/mL and 1.5×104 cells/mL respectively. 100 uL of H100 was added to 96231 cells in RPMI 1640 (Cellmax), RPM11640 (Cellmax) and cell culture plates with 10% fetal bovine serum (Cellmax), and placed in a 37°C, 5% CO2 incubator for overnight culture. The next day, the ADC to be tested was diluted in the medium to 2000 nM, 400 nM, 80 nM, 16 nM, 3.2 nM, 0.64 nM, 0.128 nM, 0.026 nM, and 100 uL of the diluted ADC was added to each well of the 96-well cell culture plate. Three replicates were set for each concentration. The negative control and blank control groups without ADC were added 100 uL of the medium to each well. After the addition of the sample, the plate was returned to the 37°C, 5% CO2 incubator for further incubation for 6 days. After incubation, the cell culture plate was removed, and the medium in the plate was aspirated using a pipette. 100 uL of the medium containing 10% CCK-8 was added to each well, and incubated at 37°C for 3 hours. After incubation, the plate was removed, placed in an enzyme-linked plate, and selected 630 nm as the reference wavelength and 450 nm as the measurement wavelength to determine the absorbance. Based on the absorbance value, the IC50 was calculated using the four-parameter regression in GraphPad.

   Click to Show/Hide
In Vitro Model Barrett adenocarcinoma OE33 cells CVCL_0471
Experiment 3 Reporting the Activity Date of This ADC [1]
Efficacy Data Half Maximal inhibitory Concentration (lC50)
27.83 nM
Method Description
Lung cancer cells NCI-H1975 were cultured in the medium until the exponential growth phase. After trypsin digestion, the cells were centrifuged and the supernatant was discarded. The medium was diluted to 3×104 cells/mL, 0.5×104 cells/mL and 1.5×104 cells/mL respectively. 100 uL of H100 was added to 96231 cells in RPMI 1640 (Cellmax), RPM11640 (Cellmax) and cell culture plates with 10% fetal bovine serum (Cellmax), and placed in a 37°C, 5% CO2 incubator for overnight culture. The next day, the ADC to be tested was diluted in the medium to 2000 nM, 400 nM, 80 nM, 16 nM, 3.2 nM, 0.64 nM, 0.128 nM, 0.026 nM, and 100 uL of the diluted ADC was added to each well of the 96-well cell culture plate. Three replicates were set for each concentration. The negative control and blank control groups without ADC were added 100 uL of the medium to each well. After the addition of the sample, the plate was returned to the 37°C, 5% CO2 incubator for further incubation for 6 days. After incubation, the cell culture plate was removed, and the medium in the plate was aspirated using a pipette. 100 uL of the medium containing 10% CCK-8 was added to each well, and incubated at 37°C for 3 hours. After incubation, the plate was removed, placed in an enzyme-linked plate, and selected 630 nm as the reference wavelength and 450 nm as the measurement wavelength to determine the absorbance. Based on the absorbance value, the IC50 was calculated using the four-parameter regression in GraphPad.

   Click to Show/Hide
In Vitro Model Lung adenocarcinoma NCI-H1975 cells CVCL_1511
WO2024140449A1 ADC1 [Investigative]
Revealed Based on the Cell Line Data
Click To Hide/Show 1 Activity Data Related to This Level
Experiment 1 Reporting the Activity Date of This ADC [2]
Efficacy Data Half Maximal inhibitory Concentration (lC50)
5-50 nM
Method Description
A Cell line test on OE-33
In Vitro Model Barrett adenocarcinoma, Adenocarcinoma of the esophagus OE-33 cells CVCL_0471
WO2024140449A1 ADC3 [Investigative]
Revealed Based on the Cell Line Data
Click To Hide/Show 1 Activity Data Related to This Level
Experiment 1 Reporting the Activity Date of This ADC [2]
Efficacy Data Half Maximal inhibitory Concentration (lC50)
5-50 nM
Method Description
A Cell line test on OE-33
In Vitro Model Barrett adenocarcinoma, Adenocarcinoma of the esophagus OE-33 cells CVCL_0471
WO2024140449A1 ADC13 [Investigative]
Revealed Based on the Cell Line Data
Click To Hide/Show 1 Activity Data Related to This Level
Experiment 1 Reporting the Activity Date of This ADC [2]
Efficacy Data Half Maximal inhibitory Concentration (lC50)
5-50 nM
Method Description
A Cell line test on OE-33
In Vitro Model Barrett adenocarcinoma, Adenocarcinoma of the esophagus OE-33 cells CVCL_0471
CN116785448A ADC4 [Investigative]
Revealed Based on the Cell Line Data
Click To Hide/Show 3 Activity Data Related to This Level
Experiment 1 Reporting the Activity Date of This ADC [1]
Efficacy Data Half Maximal inhibitory Concentration (lC50)
7.24 nM
Method Description
Human esophageal cancer cells OE33 were cultured in the medium until the exponential growth phase. After trypsin digestion, the cells were centrifuged and the supernatant was discarded. The medium was diluted to 3×104 cells/mL, 0.5×104 cells/mL and 1.5×104 cells/mL respectively. 100 uL of H100 was added to 96231 cells in RPMI 1640 (Cellmax), RPM11640 (Cellmax) and cell culture plates with 10% fetal bovine serum (Cellmax), and placed in a 37°C, 5% CO2 incubator for overnight culture. The next day, the ADC to be tested was diluted in the medium to 2000 nM, 400 nM, 80 nM, 16 nM, 3.2 nM, 0.64 nM, 0.128 nM, 0.026 nM, and 100 uL of the diluted ADC was added to each well of the 96-well cell culture plate. Three replicates were set for each concentration. The negative control and blank control groups without ADC were added 100 uL of the medium to each well. After the addition of the sample, the plate was returned to the 37°C, 5% CO2 incubator for further incubation for 6 days. After incubation, the cell culture plate was removed, and the medium in the plate was aspirated using a pipette. 100 uL of the medium containing 10% CCK-8 was added to each well, and incubated at 37°C for 3 hours. After incubation, the plate was removed, placed in an enzyme-linked plate, and selected 630 nm as the reference wavelength and 450 nm as the measurement wavelength to determine the absorbance. Based on the absorbance value, the IC50 was calculated using the four-parameter regression in GraphPad.

   Click to Show/Hide
In Vitro Model Barrett adenocarcinoma OE33 cells CVCL_0471
Experiment 2 Reporting the Activity Date of This ADC [1]
Efficacy Data Half Maximal inhibitory Concentration (lC50)
9.2 nM
Method Description
Breast cancer cells MDA-MBDMEM (Cellmax) were cultured in the medium until the exponential growth phase. After trypsin digestion, the cells were centrifuged and the supernatant was discarded. The medium was diluted to 3×104 cells/mL, 0.5×104 cells/mL and 1.5×104 cells/mL respectively. 100 uL of H100 was added to 96231 cells in RPMI 1640 (Cellmax), RPM11640 (Cellmax) and cell culture plates with 10% fetal bovine serum (Cellmax), and placed in a 37°C, 5% CO2 incubator for overnight culture. The next day, the ADC to be tested was diluted in the medium to 2000 nM, 400 nM, 80 nM, 16 nM, 3.2 nM, 0.64 nM, 0.128 nM, 0.026 nM, and 100 uL of the diluted ADC was added to each well of the 96-well cell culture plate. Three replicates were set for each concentration. The negative control and blank control groups without ADC were added 100 uL of the medium to each well. After the addition of the sample, the plate was returned to the 37°C, 5% CO2 incubator for further incubation for 6 days. After incubation, the cell culture plate was removed, and the medium in the plate was aspirated using a pipette. 100 uL of the medium containing 10% CCK-8 was added to each well, and incubated at 37°C for 3 hours. After incubation, the plate was removed, placed in an enzyme-linked plate, and selected 630 nm as the reference wavelength and 450 nm as the measurement wavelength to determine the absorbance. Based on the absorbance value, the IC50 was calculated using the four-parameter regression in GraphPad.

   Click to Show/Hide
In Vitro Model Breast adenocarcinoma MDA-MBDMEM cells CVCL_0062
Experiment 3 Reporting the Activity Date of This ADC [1]
Efficacy Data Half Maximal inhibitory Concentration (lC50)
30.88 nM
Method Description
Lung cancer cells NCI-H1975 were cultured in the medium until the exponential growth phase. After trypsin digestion, the cells were centrifuged and the supernatant was discarded. The medium was diluted to 3×104 cells/mL, 0.5×104 cells/mL and 1.5×104 cells/mL respectively. 100 uL of H100 was added to 96231 cells in RPMI 1640 (Cellmax), RPM11640 (Cellmax) and cell culture plates with 10% fetal bovine serum (Cellmax), and placed in a 37°C, 5% CO2 incubator for overnight culture. The next day, the ADC to be tested was diluted in the medium to 2000 nM, 400 nM, 80 nM, 16 nM, 3.2 nM, 0.64 nM, 0.128 nM, 0.026 nM, and 100 uL of the diluted ADC was added to each well of the 96-well cell culture plate. Three replicates were set for each concentration. The negative control and blank control groups without ADC were added 100 uL of the medium to each well. After the addition of the sample, the plate was returned to the 37°C, 5% CO2 incubator for further incubation for 6 days. After incubation, the cell culture plate was removed, and the medium in the plate was aspirated using a pipette. 100 uL of the medium containing 10% CCK-8 was added to each well, and incubated at 37°C for 3 hours. After incubation, the plate was removed, placed in an enzyme-linked plate, and selected 630 nm as the reference wavelength and 450 nm as the measurement wavelength to determine the absorbance. Based on the absorbance value, the IC50 was calculated using the four-parameter regression in GraphPad.

   Click to Show/Hide
In Vitro Model Lung adenocarcinoma NCI-H1975 cells CVCL_1511
CN116785448A ADC3 [Investigative]
Revealed Based on the Cell Line Data
Click To Hide/Show 3 Activity Data Related to This Level
Experiment 1 Reporting the Activity Date of This ADC [1]
Efficacy Data Half Maximal inhibitory Concentration (lC50)
14.86 nM
Method Description
Human esophageal cancer cells OE33 were cultured in the medium until the exponential growth phase. After trypsin digestion, the cells were centrifuged and the supernatant was discarded. The medium was diluted to 3×104 cells/mL, 0.5×104 cells/mL and 1.5×104 cells/mL respectively. 100 uL of H100 was added to 96231 cells in RPMI 1640 (Cellmax), RPM11640 (Cellmax) and cell culture plates with 10% fetal bovine serum (Cellmax), and placed in a 37°C, 5% CO2 incubator for overnight culture. The next day, the ADC to be tested was diluted in the medium to 2000 nM, 400 nM, 80 nM, 16 nM, 3.2 nM, 0.64 nM, 0.128 nM, 0.026 nM, and 100 uL of the diluted ADC was added to each well of the 96-well cell culture plate. Three replicates were set for each concentration. The negative control and blank control groups without ADC were added 100 uL of the medium to each well. After the addition of the sample, the plate was returned to the 37°C, 5% CO2 incubator for further incubation for 6 days. After incubation, the cell culture plate was removed, and the medium in the plate was aspirated using a pipette. 100 uL of the medium containing 10% CCK-8 was added to each well, and incubated at 37°C for 3 hours. After incubation, the plate was removed, placed in an enzyme-linked plate, and selected 630 nm as the reference wavelength and 450 nm as the measurement wavelength to determine the absorbance. Based on the absorbance value, the IC50 was calculated using the four-parameter regression in GraphPad.

   Click to Show/Hide
In Vitro Model Barrett adenocarcinoma OE33 cells CVCL_0471
Experiment 2 Reporting the Activity Date of This ADC [1]
Efficacy Data Half Maximal inhibitory Concentration (lC50)
20.3 nM
Method Description
Breast cancer cells MDA-MBDMEM (Cellmax) were cultured in the medium until the exponential growth phase. After trypsin digestion, the cells were centrifuged and the supernatant was discarded. The medium was diluted to 3×104 cells/mL, 0.5×104 cells/mL and 1.5×104 cells/mL respectively. 100 uL of H100 was added to 96231 cells in RPMI 1640 (Cellmax), RPM11640 (Cellmax) and cell culture plates with 10% fetal bovine serum (Cellmax), and placed in a 37°C, 5% CO2 incubator for overnight culture. The next day, the ADC to be tested was diluted in the medium to 2000 nM, 400 nM, 80 nM, 16 nM, 3.2 nM, 0.64 nM, 0.128 nM, 0.026 nM, and 100 uL of the diluted ADC was added to each well of the 96-well cell culture plate. Three replicates were set for each concentration. The negative control and blank control groups without ADC were added 100 uL of the medium to each well. After the addition of the sample, the plate was returned to the 37°C, 5% CO2 incubator for further incubation for 6 days. After incubation, the cell culture plate was removed, and the medium in the plate was aspirated using a pipette. 100 uL of the medium containing 10% CCK-8 was added to each well, and incubated at 37°C for 3 hours. After incubation, the plate was removed, placed in an enzyme-linked plate, and selected 630 nm as the reference wavelength and 450 nm as the measurement wavelength to determine the absorbance. Based on the absorbance value, the IC50 was calculated using the four-parameter regression in GraphPad.

   Click to Show/Hide
In Vitro Model Breast adenocarcinoma MDA-MBDMEM cells CVCL_0062
Experiment 3 Reporting the Activity Date of This ADC [1]
Efficacy Data Half Maximal inhibitory Concentration (lC50)
88.36 nM
Method Description
Lung cancer cells NCI-H1975 were cultured in the medium until the exponential growth phase. After trypsin digestion, the cells were centrifuged and the supernatant was discarded. The medium was diluted to 3×104 cells/mL, 0.5×104 cells/mL and 1.5×104 cells/mL respectively. 100 uL of H100 was added to 96231 cells in RPMI 1640 (Cellmax), RPM11640 (Cellmax) and cell culture plates with 10% fetal bovine serum (Cellmax), and placed in a 37°C, 5% CO2 incubator for overnight culture. The next day, the ADC to be tested was diluted in the medium to 2000 nM, 400 nM, 80 nM, 16 nM, 3.2 nM, 0.64 nM, 0.128 nM, 0.026 nM, and 100 uL of the diluted ADC was added to each well of the 96-well cell culture plate. Three replicates were set for each concentration. The negative control and blank control groups without ADC were added 100 uL of the medium to each well. After the addition of the sample, the plate was returned to the 37°C, 5% CO2 incubator for further incubation for 6 days. After incubation, the cell culture plate was removed, and the medium in the plate was aspirated using a pipette. 100 uL of the medium containing 10% CCK-8 was added to each well, and incubated at 37°C for 3 hours. After incubation, the plate was removed, placed in an enzyme-linked plate, and selected 630 nm as the reference wavelength and 450 nm as the measurement wavelength to determine the absorbance. Based on the absorbance value, the IC50 was calculated using the four-parameter regression in GraphPad.

   Click to Show/Hide
In Vitro Model Lung adenocarcinoma NCI-H1975 cells CVCL_1511
CN116785448A ADC6 [Investigative]
Revealed Based on the Cell Line Data
Click To Hide/Show 3 Activity Data Related to This Level
Experiment 1 Reporting the Activity Date of This ADC [1]
Efficacy Data Half Maximal inhibitory Concentration (lC50)
21.8 nM
Method Description
Breast cancer cells MDA-MBDMEM (Cellmax) were cultured in the medium until the exponential growth phase. After trypsin digestion, the cells were centrifuged and the supernatant was discarded. The medium was diluted to 3×104 cells/mL, 0.5×104 cells/mL and 1.5×104 cells/mL respectively. 100 uL of H100 was added to 96231 cells in RPMI 1640 (Cellmax), RPM11640 (Cellmax) and cell culture plates with 10% fetal bovine serum (Cellmax), and placed in a 37°C, 5% CO2 incubator for overnight culture. The next day, the ADC to be tested was diluted in the medium to 2000 nM, 400 nM, 80 nM, 16 nM, 3.2 nM, 0.64 nM, 0.128 nM, 0.026 nM, and 100 uL of the diluted ADC was added to each well of the 96-well cell culture plate. Three replicates were set for each concentration. The negative control and blank control groups without ADC were added 100 uL of the medium to each well. After the addition of the sample, the plate was returned to the 37°C, 5% CO2 incubator for further incubation for 6 days. After incubation, the cell culture plate was removed, and the medium in the plate was aspirated using a pipette. 100 uL of the medium containing 10% CCK-8 was added to each well, and incubated at 37°C for 3 hours. After incubation, the plate was removed, placed in an enzyme-linked plate, and selected 630 nm as the reference wavelength and 450 nm as the measurement wavelength to determine the absorbance. Based on the absorbance value, the IC50 was calculated using the four-parameter regression in GraphPad.

   Click to Show/Hide
In Vitro Model Breast adenocarcinoma MDA-MBDMEM cells CVCL_0062
Experiment 2 Reporting the Activity Date of This ADC [1]
Efficacy Data Half Maximal inhibitory Concentration (lC50)
34.91 nM
Method Description
Human esophageal cancer cells OE33 were cultured in the medium until the exponential growth phase. After trypsin digestion, the cells were centrifuged and the supernatant was discarded. The medium was diluted to 3×104 cells/mL, 0.5×104 cells/mL and 1.5×104 cells/mL respectively. 100 uL of H100 was added to 96231 cells in RPMI 1640 (Cellmax), RPM11640 (Cellmax) and cell culture plates with 10% fetal bovine serum (Cellmax), and placed in a 37°C, 5% CO2 incubator for overnight culture. The next day, the ADC to be tested was diluted in the medium to 2000 nM, 400 nM, 80 nM, 16 nM, 3.2 nM, 0.64 nM, 0.128 nM, 0.026 nM, and 100 uL of the diluted ADC was added to each well of the 96-well cell culture plate. Three replicates were set for each concentration. The negative control and blank control groups without ADC were added 100 uL of the medium to each well. After the addition of the sample, the plate was returned to the 37°C, 5% CO2 incubator for further incubation for 6 days. After incubation, the cell culture plate was removed, and the medium in the plate was aspirated using a pipette. 100 uL of the medium containing 10% CCK-8 was added to each well, and incubated at 37°C for 3 hours. After incubation, the plate was removed, placed in an enzyme-linked plate, and selected 630 nm as the reference wavelength and 450 nm as the measurement wavelength to determine the absorbance. Based on the absorbance value, the IC50 was calculated using the four-parameter regression in GraphPad.

   Click to Show/Hide
In Vitro Model Barrett adenocarcinoma OE33 cells CVCL_0471
Experiment 3 Reporting the Activity Date of This ADC [1]
Efficacy Data Half Maximal inhibitory Concentration (lC50)
78.83 nM
Method Description
Lung cancer cells NCI-H1975 were cultured in the medium until the exponential growth phase. After trypsin digestion, the cells were centrifuged and the supernatant was discarded. The medium was diluted to 3×104 cells/mL, 0.5×104 cells/mL and 1.5×104 cells/mL respectively. 100 uL of H100 was added to 96231 cells in RPMI 1640 (Cellmax), RPM11640 (Cellmax) and cell culture plates with 10% fetal bovine serum (Cellmax), and placed in a 37°C, 5% CO2 incubator for overnight culture. The next day, the ADC to be tested was diluted in the medium to 2000 nM, 400 nM, 80 nM, 16 nM, 3.2 nM, 0.64 nM, 0.128 nM, 0.026 nM, and 100 uL of the diluted ADC was added to each well of the 96-well cell culture plate. Three replicates were set for each concentration. The negative control and blank control groups without ADC were added 100 uL of the medium to each well. After the addition of the sample, the plate was returned to the 37°C, 5% CO2 incubator for further incubation for 6 days. After incubation, the cell culture plate was removed, and the medium in the plate was aspirated using a pipette. 100 uL of the medium containing 10% CCK-8 was added to each well, and incubated at 37°C for 3 hours. After incubation, the plate was removed, placed in an enzyme-linked plate, and selected 630 nm as the reference wavelength and 450 nm as the measurement wavelength to determine the absorbance. Based on the absorbance value, the IC50 was calculated using the four-parameter regression in GraphPad.

   Click to Show/Hide
In Vitro Model Lung adenocarcinoma NCI-H1975 cells CVCL_1511
CN116785448A ADC7 [Investigative]
Revealed Based on the Cell Line Data
Click To Hide/Show 3 Activity Data Related to This Level
Experiment 1 Reporting the Activity Date of This ADC [1]
Efficacy Data Half Maximal inhibitory Concentration (lC50)
79.45 nM
Method Description
Breast cancer cells MDA-MBDMEM (Cellmax) were cultured in the medium until the exponential growth phase. After trypsin digestion, the cells were centrifuged and the supernatant was discarded. The medium was diluted to 3×104 cells/mL, 0.5×104 cells/mL and 1.5×104 cells/mL respectively. 100 uL of H100 was added to 96231 cells in RPMI 1640 (Cellmax), RPM11640 (Cellmax) and cell culture plates with 10% fetal bovine serum (Cellmax), and placed in a 37°C, 5% CO2 incubator for overnight culture. The next day, the ADC to be tested was diluted in the medium to 2000 nM, 400 nM, 80 nM, 16 nM, 3.2 nM, 0.64 nM, 0.128 nM, 0.026 nM, and 100 uL of the diluted ADC was added to each well of the 96-well cell culture plate. Three replicates were set for each concentration. The negative control and blank control groups without ADC were added 100 uL of the medium to each well. After the addition of the sample, the plate was returned to the 37°C, 5% CO2 incubator for further incubation for 6 days. After incubation, the cell culture plate was removed, and the medium in the plate was aspirated using a pipette. 100 uL of the medium containing 10% CCK-8 was added to each well, and incubated at 37°C for 3 hours. After incubation, the plate was removed, placed in an enzyme-linked plate, and selected 630 nm as the reference wavelength and 450 nm as the measurement wavelength to determine the absorbance. Based on the absorbance value, the IC50 was calculated using the four-parameter regression in GraphPad.

   Click to Show/Hide
In Vitro Model Breast adenocarcinoma MDA-MBDMEM cells CVCL_0062
Experiment 2 Reporting the Activity Date of This ADC [1]
Efficacy Data Half Maximal inhibitory Concentration (lC50)
125.9 nM
Method Description
Human esophageal cancer cells OE33 were cultured in the medium until the exponential growth phase. After trypsin digestion, the cells were centrifuged and the supernatant was discarded. The medium was diluted to 3×104 cells/mL, 0.5×104 cells/mL and 1.5×104 cells/mL respectively. 100 uL of H100 was added to 96231 cells in RPMI 1640 (Cellmax), RPM11640 (Cellmax) and cell culture plates with 10% fetal bovine serum (Cellmax), and placed in a 37°C, 5% CO2 incubator for overnight culture. The next day, the ADC to be tested was diluted in the medium to 2000 nM, 400 nM, 80 nM, 16 nM, 3.2 nM, 0.64 nM, 0.128 nM, 0.026 nM, and 100 uL of the diluted ADC was added to each well of the 96-well cell culture plate. Three replicates were set for each concentration. The negative control and blank control groups without ADC were added 100 uL of the medium to each well. After the addition of the sample, the plate was returned to the 37°C, 5% CO2 incubator for further incubation for 6 days. After incubation, the cell culture plate was removed, and the medium in the plate was aspirated using a pipette. 100 uL of the medium containing 10% CCK-8 was added to each well, and incubated at 37°C for 3 hours. After incubation, the plate was removed, placed in an enzyme-linked plate, and selected 630 nm as the reference wavelength and 450 nm as the measurement wavelength to determine the absorbance. Based on the absorbance value, the IC50 was calculated using the four-parameter regression in GraphPad.

   Click to Show/Hide
In Vitro Model Barrett adenocarcinoma OE33 cells CVCL_0471
Experiment 3 Reporting the Activity Date of This ADC [1]
Efficacy Data Half Maximal inhibitory Concentration (lC50)
202.7 nM
Method Description
Lung cancer cells NCI-H1975 were cultured in the medium until the exponential growth phase. After trypsin digestion, the cells were centrifuged and the supernatant was discarded. The medium was diluted to 3×104 cells/mL, 0.5×104 cells/mL and 1.5×104 cells/mL respectively. 100 uL of H100 was added to 96231 cells in RPMI 1640 (Cellmax), RPM11640 (Cellmax) and cell culture plates with 10% fetal bovine serum (Cellmax), and placed in a 37°C, 5% CO2 incubator for overnight culture. The next day, the ADC to be tested was diluted in the medium to 2000 nM, 400 nM, 80 nM, 16 nM, 3.2 nM, 0.64 nM, 0.128 nM, 0.026 nM, and 100 uL of the diluted ADC was added to each well of the 96-well cell culture plate. Three replicates were set for each concentration. The negative control and blank control groups without ADC were added 100 uL of the medium to each well. After the addition of the sample, the plate was returned to the 37°C, 5% CO2 incubator for further incubation for 6 days. After incubation, the cell culture plate was removed, and the medium in the plate was aspirated using a pipette. 100 uL of the medium containing 10% CCK-8 was added to each well, and incubated at 37°C for 3 hours. After incubation, the plate was removed, placed in an enzyme-linked plate, and selected 630 nm as the reference wavelength and 450 nm as the measurement wavelength to determine the absorbance. Based on the absorbance value, the IC50 was calculated using the four-parameter regression in GraphPad.

   Click to Show/Hide
In Vitro Model Lung adenocarcinoma NCI-H1975 cells CVCL_1511
WO2024140449A1 ADC5 [Investigative]
Revealed Based on the Cell Line Data
Click To Hide/Show 1 Activity Data Related to This Level
Experiment 1 Reporting the Activity Date of This ADC [2]
Efficacy Data Half Maximal inhibitory Concentration (lC50) > 250 nM
Method Description
A Cell line test on OE-33
In Vitro Model Barrett adenocarcinoma, Adenocarcinoma of the esophagus OE-33 cells CVCL_0471
WO2024140449A1 ADC7 [Investigative]
Revealed Based on the Cell Line Data
Click To Hide/Show 1 Activity Data Related to This Level
Experiment 1 Reporting the Activity Date of This ADC [2]
Efficacy Data Half Maximal inhibitory Concentration (lC50) > 250 nM
Method Description
A Cell line test on OE-33
In Vitro Model Barrett adenocarcinoma, Adenocarcinoma of the esophagus OE-33 cells CVCL_0471
References
Ref 1 2'-deoxy-2',2'-difluorocytidine ProTides and antibody-drug conjugates and their preparation and uses
Ref 2 Antibody-drug conjugates of N-oxacycloalkyl substituted camptothecin derivatives