General Information of This Antibody
Antibody ID
ANI0DKNXJ
Antibody Name
OBI-888
Antibody Type
Monoclonal antibody (mAb)
Antibody Subtype
Humanized IgG
Antigen Name
Globo H (globotriaosylceramide)
 Antigen Info 
Click to Show/Hide the Sequence Information of This Antibody
Heavy Chain Sequence
QITLKESGPTLVKPTQTLTLTCTFSGFSLYTFDMGVGWIRQPPGKGLEWLAHIWWDGDKY
YNPALKSRLTISKDTSKNQVVLTMTNMDPVDTATYYCARVRGLHRYYYWFAYWGQGTLVT
VSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVL
QSSGLYSLSSWTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELL
GGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQ
YNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSR
DELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKS
RWQQGNVFSCSVNIHEALHNHYTQKSLSLSPGK
    Click to Show/Hide
Light Chain Sequence
ETVLTQSPATLSLSPGERATLSCRASSSVSYMfHWYQQKPGKSPKPWIYATSNKASGVPS
RFSGSGSGTDFTFTISSLQPEDIATYYCQQWSRRPFTFGQGTKVEIKRTVAAPSVFIFPP
SDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLT
LSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC
    Click to Show/Hide
Each Antibody-drug Conjugate Related to This Antibody
Full Information of The Activity Data of The ADC(s) Related to This Antibody
OBI-999 [Phase 1/2 (discontinued)]
Identified from the Human Clinical Data
Click To Hide/Show 2 Activity Data Related to This Level
Experiment 1 Reporting the Activity Date of This ADC [1]
Patients Enrolled
Advanced solid tumors that had been previously treated with standard-of-care therapy and their physicians had determined that such therapy was no longer effective, or patients had declined to receive further standard-of-care treatments.
Administration Dosage
The starting dose of 0.40 mg/kg on day 1 of each 21-day cycle; A standard 3 + 3 dose-escalation design was used, and doses of 0.80, 1.20, and 1.60 mg/kg were also administered on day 1 of each 21-day cycle; intravenous infusion over 60 minutes.
Related Clinical Trial
NCT Number NCT04084366  Clinical Status Phase 1
Clinical Description
A phase 1/2, open-label, dose-escalation and cohort-expansion study evaluating the safety, pharmacokinetics, and therapeutic activity of OBI-999 in patients with advanced solid tumors.
Primary Endpoint
The incidence of dose-limiting toxicities and adverse events and determination of the maximum tolerated dose (MTD)/recommended phase II dose.
Experiment 2 Reporting the Activity Date of This ADC [4]
Patients Enrolled
Inclusion criteria require patients aged &ge;18 with advanced solid tumors (refractory to/intolerant of standard therapy), measurable disease (RECIST 1.1), ECOG 0-1, adequate organ function (ALT/AST &le;3&times;ULN [&le;5&times;ULN if liver mets], bilirubin &le;1.5&times;ULN, ANC &ge;1,500/uL, platelets &ge;100,000/uL), and Globo H H-score &ge;100 (Cohort-Expansion). HIV/HBV/HCV-infected patients are eligible if controlled. Exclusions include recent chemotherapy/radiation (<3 weeks), major surgery (<28 days), Grade &ge;2 neuropathy, prior Globo H-targeted therapy, uncontrolled CNS metastases, cardiac dysfunction, or concurrent prohibited medications.

   Click to Show/Hide
Administration Dosage
Part A: Five cohorts at escalating dose levels 0.4, 0.8, 1.2, 1.6 and 2.0 mg/kg (capping calculations at a maximum at 100 kg) of OBI-999 liquid form via IV infusion to establish maximum tolerated dose (MTD) and Recommended phase 2 dose (RP2D).Part B: Five cohorts of patients at RP2D of OBI-999 liquid form, as determined from Part A, via IV infusion.

   Click to Show/Hide
Related Clinical Trial
NCT Number NCT04084366  Clinical Status PHASE1|||PHASE2
Clinical Description
A Phase 1/2, Open-Label, Dose-Escalation and Cohort-Expansion Study Evaluating the Safety, Pharmacokinetics, and Therapeutic Activity of OBI-999 in Patients with Advanced Solid Tumors
Primary Endpoint
The primary objective is to assess the clinical benefit of OBI-999 through Objective Response Rate (ORR: CR+PR) per RECIST 1.1, evaluated every 6 weeks (±7 days) during initial 3 months, then every 9 weeks (±7 days) until treatment discontinuation, progression, death, or new therapy initiation-whichever occurs first within ~2 years (up to 35 cycles).

   Click to Show/Hide
Other Endpoint
Key secondary endpoints include preliminary efficacy (ORR, Clinical Benefit Rate [CBR], Duration of Response [DOR], PFS per RECIST 1.1) and immunogenicity (anti-drug antibodies [ADAs]), analyzed from Week 1 to Week 106. Pharmacokinetics (PK) of OBI-999 and its active metabolite (MMAE) will be assessed via non-compartmental methods during Cycles 1-2, measuring Cmax, AUC, t1/2, clearance (Cl), Tmax, and volume of distribution (Vd).

   Click to Show/Hide
Discovered Using Cell Line-derived Xenograft Model
Click To Hide/Show 9 Activity Data Related to This Level
Experiment 1 Reporting the Activity Date of This ADC [2]
Efficacy Data Tumor Growth Inhibition value (TGI) ≈ 34% Positive Globo H expression (Globo H+++/++)
Method Description
Mice were treated with an intravenous dose of the ADCs at 0.3 mg/kg, qw*6.
In Vivo Model MCF-7 CDX model
In Vitro Model Invasive breast carcinoma MCF-7 cells CVCL_0031
Experiment 2 Reporting the Activity Date of This ADC [2]
Efficacy Data Tumor Growth Inhibition value (TGI) ≈ 60% Positive Globo H expression (Globo H+++/++)
Method Description
Mice were treated with an intravenous dose of the ADCs at 1 mg/kg, qw*6.
In Vivo Model MCF-7 CDX model
In Vitro Model Invasive breast carcinoma MCF-7 cells CVCL_0031
Experiment 3 Reporting the Activity Date of This ADC [2]
Efficacy Data Tumor Growth Inhibition value (TGI) ≈ 83% Positive Globo H expression (Globo H+++/++)
Method Description
Mice were treated with an intravenous dose of the ADCs at 1 mg/kg, qw*4.
In Vivo Model NCI-N87 CDX model
In Vitro Model Gastric tubular adenocarcinoma NCI-N87 cells CVCL_1603
Experiment 4 Reporting the Activity Date of This ADC [2]
Efficacy Data Tumor Growth Inhibition value (TGI) ≈ 85% Positive Globo H expression (Globo H+++/++)
Method Description
Mice were treated with an intravenous dose of the ADCs at 10 mg/kg, qw*4.
In Vivo Model NCI-H526 CDX model
In Vitro Model Lung small cell carcinoma NCI-H526 cells CVCL_1569
Experiment 5 Reporting the Activity Date of This ADC [2]
Efficacy Data Tumor Growth Inhibition value (TGI) ≈ 95% Positive Globo H expression (Globo H+++/++)
Method Description
Mice were treated with an intravenous dose of the ADCs at 10 mg/kg, qw*2.
In Vivo Model MCF-7 CDX model
In Vitro Model Invasive breast carcinoma MCF-7 cells CVCL_0031
Experiment 6 Reporting the Activity Date of This ADC [2]
Efficacy Data Tumor Growth Inhibition value (TGI) ≈ 97% Positive Globo H expression (Globo H+++/++)
Method Description
Mice were treated with an intravenous dose of the ADCs at 10 mg/kg, qw*4.
In Vivo Model NCI-N87 CDX model
In Vitro Model Gastric tubular adenocarcinoma NCI-N87 cells CVCL_1603
Experiment 7 Reporting the Activity Date of This ADC [2]
Efficacy Data Tumor Growth Inhibition value (TGI) ≈ 97% Positive Globo H expression (Globo H+++/++)
Method Description
Mice were treated with an intravenous dose of the ADCs at 1-3 mg/kg, qw*4.
In Vivo Model NCI-N87 CDX model
In Vitro Model Gastric tubular adenocarcinoma NCI-N87 cells CVCL_1603
Experiment 8 Reporting the Activity Date of This ADC [2]
Efficacy Data Tumor Growth Inhibition value (TGI) ≈ 98% Positive Globo H expression (Globo H+++/++)
Method Description
Mice were treated with an intravenous dose of the ADCs at 3 mg/kg, qw*6.
In Vivo Model MCF-7 CDX model
In Vitro Model Invasive breast carcinoma MCF-7 cells CVCL_0031
Experiment 9 Reporting the Activity Date of This ADC [2]
Efficacy Data Tumor Growth Inhibition value (TGI) ≈ 99% Positive Globo H expression (Globo H+++/++)
Method Description
Mice were treated with an intravenous dose of the ADCs at 10 mg/kg, qw*4.
In Vivo Model HPAC CDX model
In Vitro Model Pancreatic adenocarcinoma HPAC cells CVCL_3517
Revealed Based on the Cell Line Data
Click To Hide/Show 1 Activity Data Related to This Level
Experiment 1 Reporting the Activity Date of This ADC [3]
Efficacy Data Tumor Growth Inhibition value (TGI) ≈ 70.70%
Method Description
In vivo , In each animal study,the antitumor efficacy was evaluated with doses of 1.00, 3.00, or 10.00 mg/kg of OBI-999 via i.v. injection. In NCI-N87 xenograft model,treatment groups of MMAE 0.191 mg/kg and Ctrl-ADC 3 mg/kg were also included. Each study utilized 6 to 8 mice per group.
In Vitro Model Breast adenocarcinoma MDA-MB-231 cells CVCL_0062
Breast adenocarcinoma HCC1428 cells CVCL_1252
References
Ref 1 First-in-Human Study of OBI-999, a Globo H-Targeting Antibody-Drug Conjugate, in Patients With Advanced Solid Tumors. JCO Precis Oncol. 2023 Jan;7:e2200496.
Ref 2 Conjugated biological molecules, pharmaceutical compositions and methods.
Ref 3 Preclinical Studies of OBI-999: A Novel Globo H-Targeting Antibody-Drug Conjugate. Mol Cancer Ther. 2021 Jun;20(6):1121-1132.
Ref 4 Phase 1/2 Study of OBI-999 in Patients with Advanced Solid Tumors