General Information of This Antibody (ID: ANI0BOAGM)
Antibody Name
Trastuzumab variant
Organization
Alteogen, Inc.; Shenyang Sunshine Pharmaceutical Co., Ltd.
Synonyms
Trastuzumab variant
   Click to Show/Hide
Antibody Type
Monoclonal antibody (mAb)
Antigen Name
Receptor tyrosine-protein kinase erbB-2 (ERBB2)
 Antigen Info 
Click to Show/Hide the Sequence Information of This Antibody
Heavy Chain Sequence
EVQLVESGGGLVQPGGSLRLSCAASGFNIKDTYIHWVRQAPGKGLEWVARIYPTNGYTRY
ADSVKGRFTISADTSKNTAYLQMNSLRAEDTAVYYCSRWGGDGFYAMDYWGQGTLVTVSS
ASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSS
GLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGG
PSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYN
STYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREE
MTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRW
QQGNVFSCSVMHEALHNHYTQKSLSLSPGK
    Click to Show/Hide
Light Chain Sequence
DIQMTQSPSSLSASVGDRVTITCRASQDVNTAVAWYQQKPGKAPKLLIYSASFLYSGVPS
RFSGSRSGTDFTLTISSLQPEDFATYYCQQHYTTPPTFGQGTKVEIKRTVAAPSVFIFPP
SDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLT
LSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC
    Click to Show/Hide
Each Antibody-drug Conjugate Related to This Antibody
Full Information of The Activity Data of The ADC(s) Related to This Antibody
GQ1005 [Phase 3]
Identified from the Human Clinical Data
Click To Hide/Show 2 Activity Data Related to This Level
Experiment 1 Reporting the Activity Date of This ADC [1]
Efficacy Data Objective Response Rate (ORR)
27.60%
Patients Enrolled
Eligible participants are adults (≥18 years) with advanced/metastatic HER2-expressing solid tumors (IHC 1+/2+/3+ or HER2 mutations) who failed or are intolerant to standard therapy. Key inclusion criteria: ECOG 0-1, adequate organ function, measurable lesions per RECIST 1.1, and washout from prior therapies. Exclusion criteria include uncontrolled brain metastases, cardiovascular disease, significant pulmonary conditions, prior topoisomerase I inhibitor-ADCs, active infections (HIV/HBV/HCV), pregnancy, and unresolved toxicity >Grade 1 from prior treatments.

   Click to Show/Hide
Administration Dosage
GQ1005 will be administered intravenously every 21 days.
Related Clinical Trial
NCT Number NCT06154343  Clinical Status PHASE1
Clinical Description
A Phase 1, First-In-Human, Multicenter, Open-Label,Dose-Escalation and Extension Study of GQ1005 in Subjects With HER2-Expressing Advanced Solid Tumors
Primary Endpoint
The study evaluates the safety and tolerability of GQ1005, including incidence and severity of adverse events (AEs) graded by NCI-CTCAE v5.0, dose-limiting toxicities (DLTs) during the first 21-day cycle, and determination of the maximal tolerance dose (MTD) or recommended phase II dose (RP2D) based on cumulative cohort data.
Other Endpoint
The pharmacokinetics (PK) of GQ1005 will be assessed via maximum concentration (Cmax), time to peak concentration (Tmax), and area under the curve (AUC). Antitumor efficacy measures include overall response rate (ORR), duration of response (DOR), disease control rate (DCR), time-to-response (TTR), progression-free survival (PFS), and overall survival (OS), all evaluated per RECIST 1.1. Immunogenicity will be assessed by anti-drug antibody (ADA) formation.

   Click to Show/Hide
Experiment 2 Reporting the Activity Date of This ADC [1]
Efficacy Data Disease control rate (DCR)
69%
Patients Enrolled
Eligible participants are adults (≥18 years) with advanced/metastatic HER2-expressing solid tumors (IHC 1+/2+/3+ or HER2 mutations) who failed or are intolerant to standard therapy. Key inclusion criteria: ECOG 0-1, adequate organ function, measurable lesions per RECIST 1.1, and washout from prior therapies. Exclusion criteria include uncontrolled brain metastases, cardiovascular disease, significant pulmonary conditions, prior topoisomerase I inhibitor-ADCs, active infections (HIV/HBV/HCV), pregnancy, and unresolved toxicity >Grade 1 from prior treatments.

   Click to Show/Hide
Administration Dosage
GQ1005 will be administered intravenously every 21 days.
Related Clinical Trial
NCT Number NCT06154343  Clinical Status PHASE1
Clinical Description
A Phase 1, First-In-Human, Multicenter, Open-Label,Dose-Escalation and Extension Study of GQ1005 in Subjects With HER2-Expressing Advanced Solid Tumors
Primary Endpoint
The study evaluates the safety and tolerability of GQ1005, including incidence and severity of adverse events (AEs) graded by NCI-CTCAE v5.0, dose-limiting toxicities (DLTs) during the first 21-day cycle, and determination of the maximal tolerance dose (MTD) or recommended phase II dose (RP2D) based on cumulative cohort data.
Other Endpoint
The pharmacokinetics (PK) of GQ1005 will be assessed via maximum concentration (Cmax), time to peak concentration (Tmax), and area under the curve (AUC). Antitumor efficacy measures include overall response rate (ORR), duration of response (DOR), disease control rate (DCR), time-to-response (TTR), progression-free survival (PFS), and overall survival (OS), all evaluated per RECIST 1.1. Immunogenicity will be assessed by anti-drug antibody (ADA) formation.

   Click to Show/Hide
GQ1001 [Phase 1/2]
Identified from the Human Clinical Data
Click To Hide/Show 4 Activity Data Related to This Level
Experiment 1 Reporting the Activity Date of This ADC [2]
Patients Enrolled
Eligible patients are HER2+ metastatic breast cancer patients (IHC3+/ISH+, ECOG 0-1, LVEF≥50%) with ≥1 prior trastuzumab-based therapy, measurable lesions, and adequate organ function, excluding those with active CNS metastases, prior DM1-ADC/pyrotinib use (exceptions apply), significant cardiac/ILD history, or uncontrolled infections.
Administration Dosage
Patients will receive the recommended phase 2 dose of GQ1001 determined in phase I. GQ1001 infusions on day 1 of each 21-day cycle combinate with pyrotinib 320mg orally once daily until disease progression or unacceptable toxicity.
Related Clinical Trial
NCT Number NCT05575804  Clinical Status PHASE1|||PHASE2
Clinical Description
Phase Ib/II Study of GQ1001 and Pyrotinib in HER2 Positive Metastatic Breast Cancer Patients Who Had Failed Previous Anti-HER2 Treatment(GRACE)
Primary Endpoint
The study evaluates dose-limiting toxicities (DLTs) and maximum tolerated dose (MTD) in Phase I (21-day cycles), along with treatment-related adverse events (CTCAE v5.0) and objective response rate (ORR, RECIST 1.1) over 24 months.
Other Endpoint
Pharmacokinetic parameters (Cmax, Ctrough, AUC) for GQ1001, DM1, pyrotinib, and anti-HER2 antibody are assessed in Phase I, while efficacy outcomes (ORR, DoR, DCR, PFS per RECIST 1.1) are tracked across both phases for 24 months.
Experiment 2 Reporting the Activity Date of This ADC [3]
Patients Enrolled
Eligible patients are adults (≥18) with HER2+ advanced/metastatic solid tumors (breast, gastric/GEJ, or other) refractory to standard therapy, ECOG 0-1, LVEF≥50%, and adequate organ function, excluding those with active brain metastases, significant cardiac/pulmonary disease, unresolved toxicities (>Grade 1), uncontrolled infections, or prior cumulative anthracycline dose >360mg/m2 doxorubicin-equivalent.

   Click to Show/Hide
Administration Dosage
GQ1001 will be administered intravenously every 21 days. Dose Escalation will be guided by a modified 3+3 design.
Related Clinical Trial
NCT Number NCT04450732  Clinical Status PHASE1
Clinical Description
A Phase 1, First-In-Human, Multicenter, Open-Label, Study of GQ1001, a HER2 Targeted Antibody-Drug Conjugate, Administered Intravenously, in Adult Patients With HER2-Positive Advanced Solid Tumors
Primary Endpoint
The study evaluates dose-limiting toxicities (DLTs) and determines maximum tolerated dose (MTD) or recommended expansion dose (DRDE) during the first 21-day cycle, with adverse events assessed per NCI CTCAE v5.0 criteria.
Other Endpoint
Safety assessments include AE monitoring, lab abnormalities, and pharmacokinetic parameters (AUC, Cmax, Tmax, T1/2, MRT, Vd) of GQ1001, along with efficacy outcomes (ORR, DCR, DoR, PFS per RECIST 1.1) and immunogenicity (anti-drug antibodies) over approximately 1 year.
Experiment 3 Reporting the Activity Date of This ADC [4]
Efficacy Data Partial Response (PR)
40%
Patients Enrolled
HER2-positive advanced solid tumors.
Administration Dosage
Administered intravenously as a monotherapy on Day 1 of 21-day cycles. The starting dose was 1.20 mg/kg, followed by 2.40, 3.60, 4.80, 6.00, 7.20 and 8.40 mg/kg.
Related Clinical Trial
NCT Number NCT04450732  Clinical Status Phase 1
Clinical Description
A phase 1, first-in-human, multicenter, open-label, study of GQ1001, a HER2 targeted antibody-drug conjugate, administered intravenously, in adult patients with HER2-positive advanced solid tumors.
Experiment 4 Reporting the Activity Date of This ADC [5]
Related Clinical Trial
NCT Number NCT05575804  Clinical Status Phase 1/2
Clinical Description
Phase 1b/2 study of GQ1001 and pyrotinib in HER2 positive metastatic breast cancer patients who had failed previous anti-HER2 treatment GRACE.
ALT-P7 [Phase 1 (discontinued)]
Identified from the Human Clinical Data
Click To Hide/Show 3 Activity Data Related to This Level
Experiment 1 Reporting the Activity Date of This ADC [6]
Efficacy Data Progression Free Survival
6.2 months
Patients Enrolled
Eligible patients must be &ge;19 years old with ECOG 0-1, adequate organ function (hematologic/renal/hepatic), and negative pregnancy status. Key exclusions include trastuzumab intolerance, active CNS metastases, unresolved Grade &ge;2 toxicities, recent anticancer therapies (<3 weeks), significant cardiopulmonary dysfunction (LVEF<50%, NYHA II-IV), active infections (HIV/HBV/HCV), or other malignancies within 5 years (except specified cured cancers).

   Click to Show/Hide
Administration Dosage
8 groups: 0.3 mg/kg, 0.6 mg/kg, 1.2 mg/kg, 2.4 mg/kg, 3.6 mg/kg, 4.2 mg/kg, 4.5 mg/kg, 4.8 mg/kg, Administration: Day 1 of each 3-week cycle
Related Clinical Trial
NCT Number NCT03281824  Clinical Status PHASE1
Clinical Description
Open-Label, Dose Increase and Phase I Study of ALT-P7 to Determine Safety, Tolerability, Pharmacokinetics for HER2 Positive Metastatic Breast Cancer Patients Who Have Progressed on Previous Trastuzumab-Based Therapy
Primary Endpoint
The study evaluates safety endpoints including dose-limiting toxicities (DLTs) during the 21-day assessment period to determine maximum tolerated dose (MTD) or recommended phase II dose (RP2D), along with treatment-emergent adverse events (TEAEs) graded by CTCAE v4.03 with special focus on immune-related adverse events (irAEs) monitored for up to 4 weeks post-treatment.

   Click to Show/Hide
Other Endpoint
Pharmacokinetic analysis assesses ALT-P7 metabolism across dose groups (1.2-5.4 mg/kg) from administration to elimination, while immunogenicity testing evaluates anti-drug antibody responses. Efficacy outcomes are analyzed descriptively after Cycle 2 (42 days), including subject counts, means, standard deviations, and ranges for each dose cohort.
Experiment 2 Reporting the Activity Date of This ADC [6]
Efficacy Data Disease control rate (DCR)
77.30%
Patients Enrolled
Eligible patients must be &ge;19 years old with ECOG 0-1, adequate organ function (hematologic/renal/hepatic), and negative pregnancy status. Key exclusions include trastuzumab intolerance, active CNS metastases, unresolved Grade &ge;2 toxicities, recent anticancer therapies (<3 weeks), significant cardiopulmonary dysfunction (LVEF<50%, NYHA II-IV), active infections (HIV/HBV/HCV), or other malignancies within 5 years (except specified cured cancers).

   Click to Show/Hide
Administration Dosage
8 groups: 0.3 mg/kg, 0.6 mg/kg, 1.2 mg/kg, 2.4 mg/kg, 3.6 mg/kg, 4.2 mg/kg, 4.5 mg/kg, 4.8 mg/kg, Administration: Day 1 of each 3-week cycle
Related Clinical Trial
NCT Number NCT03281824  Clinical Status PHASE1
Clinical Description
Open-Label, Dose Increase and Phase I Study of ALT-P7 to Determine Safety, Tolerability, Pharmacokinetics for HER2 Positive Metastatic Breast Cancer Patients Who Have Progressed on Previous Trastuzumab-Based Therapy
Primary Endpoint
The study evaluates safety endpoints including dose-limiting toxicities (DLTs) during the 21-day assessment period to determine maximum tolerated dose (MTD) or recommended phase II dose (RP2D), along with treatment-emergent adverse events (TEAEs) graded by CTCAE v4.03 with special focus on immune-related adverse events (irAEs) monitored for up to 4 weeks post-treatment.

   Click to Show/Hide
Other Endpoint
Pharmacokinetic analysis assesses ALT-P7 metabolism across dose groups (1.2-5.4 mg/kg) from administration to elimination, while immunogenicity testing evaluates anti-drug antibody responses. Efficacy outcomes are analyzed descriptively after Cycle 2 (42 days), including subject counts, means, standard deviations, and ranges for each dose cohort.
Experiment 3 Reporting the Activity Date of This ADC [8]
Efficacy Data Objective Response Rate (ORR)
13.30%
Patients Enrolled
Patients with HER2-positive advanced breast cancer progressive to at least two kinds of prior anti-HER2 treatment.
Administration Dosage
0.30-4.80 mg/kg iv administered once every 3 weeks.
Related Clinical Trial
NCT Number NCT03281824  Clinical Status Phase 1
Clinical Description
Open-label, dose increase and phase 1 study of ALT-P7 to determine safety, tolerability, pharmacokinetics for HER2 positive metastatic breast cancer patients who have progressed on previous trastuzumab-based therapy.
ADCT-502 [Phase 1 (discontinued)]
Identified from the Human Clinical Data
Click To Hide/Show 2 Activity Data Related to This Level
Experiment 1 Reporting the Activity Date of This ADC [7]
Patients Enrolled
Key eligibility: Adults (&ge;18) with HER2+ metastatic solid tumors, ECOG 0-2 (dose escalation)/0-1 (expansion), adequate organ function (ANC&ge;1500, platelets&ge;100K, bilirubin&le;1.5&times;ULN, CrCl&ge;60). Exclusions: Grade&ge;3 antibody hypersensitivity, CNS metastases, active HBV/HCV/HIV, recent anticancer therapy, pregnancy, or uncontrolled comorbidities.

   Click to Show/Hide
Administration Dosage
Part 1 (dose escalation): Participants received an infusion of ADCT-502, at escalating doses. Part 1 continued until the maximum tolerated dose or the recommended dose (s) and schedule (s) for expansion were determined.Part 2 (expansion): Participants were due to be assigned to the recommended dose level of ADCT-502 as identified in Part 1 by the Dose Escalation Steering Committee.

   Click to Show/Hide
Related Clinical Trial
NCT Number NCT03125200  Clinical Status PHASE1
Clinical Description
A Phase 1, Open-Label, Dose-Escalation Study to Evaluate the Safety, Tolerability, Pharmacokinetics, and Antitumor Activity of ADCT-502 in Patients With Advanced Solid Tumors With HER2 Expression
Primary Endpoint
Primary endpoints include DLT assessment (Grade ≥3 per CTCAE v4) during first 21-day cycle, TEAE/SAE monitoring through treatment +30 days, and comprehensive safety evaluations (labs, physical exams, ECOG status, vitals, ECG).
Other Endpoint
Secondary objectives cover tumor response (ORR/DCR/DOR/PFS/OS assessed q12w per RECIST 1.1), PK analysis (AUC/Cmax/Tmax for total antibody, DAR≥0 species, PBD-conjugated antibody, free warhead SG3199), and immunogenicity (ADA titers).
Experiment 2 Reporting the Activity Date of This ADC [9]
Efficacy Data Objective Response Rate (ORR)
20%
Patients Enrolled
Patients with HER2-positive advanced solid tumors.
Administration Dosage
Seven dose cohorts (30, 60, 120, 150, 180, 210, 240 ug/kg on day 1, iv once every 3 weeks.
Related Clinical Trial
NCT Number NCT03125200  Clinical Status Phase 1
Clinical Description
A phase 1, open-label, dose-escalation study to evaluate the safety, tolerability, pharmacokinetics, and antitumor activity of ADCT-502 in patients with advanced solid tumors with HER2 expression.
References
Ref 1 A Study of GQ1005 in Subjects With HER2-Expressing Advanced Solid Tumors
Ref 2 GQ1001 Combined With Pyrotinib for Treatment With HER2 Positive Metastatic Breast Cancer
Ref 3 Safety of GQ1001 in Adult Patients With HER2-Positive Advanced Solid Tumors
Ref 4 GQ1001: A next generation HER2-targeting ADC that exhibits promising early clinical efficacy with excellent tolerance in a multi-center, Phase Ia study. Cancer Res (2023) 83 (8_Supplement): CT178.
Ref 5 Phase Ib/II Study of GQ1001 and Pyrotinib in HER2 Positive Metastatic Breast Cancer Patients Who Had Failed Previous Anti-HER2 TreatmentGRACE, NCT05575804
Ref 6 Clinical Study of ALT-P7 to Determine Safety, Tolerability and Pharmacokinetics in Breast Cancer Patients
Ref 7 Study of ADCT-502 in Patients With Advanced Solid Tumors Withhuman Epidermal Growth Factor Receptor-2 (HER2) Expression
Ref 8 A Phase 1, Open-Label, Dose-Escalation Study of the Safety and Efficacy of Anti-CD38 Antibody Drug Conjugate (STI-6129) in Patients with Relapsed or Refractory Multiple Myeloma. Blood (2021) 138 (Supplement 1): 4763.
Ref 9 A Phase 1, Open-Label, Dose-Escalation Study to Evaluate the Safety, Tolerability, Pharmacokinetics, and Antitumor Activity of ADCT-502 in Patients With Advanced Solid Tumors With HER2 Expression