Antibody Information
General Information of This Antibody (ID: ANI0BOAGM)
| Antibody Name | Trastuzumab variant |
|||||
|---|---|---|---|---|---|---|
| Organization | Alteogen, Inc.; Shenyang Sunshine Pharmaceutical Co., Ltd. |
|||||
| Synonyms |
Trastuzumab variant
Click to Show/Hide
|
|||||
| Antibody Type | Monoclonal antibody (mAb) |
|||||
| Antigen Name | Receptor tyrosine-protein kinase erbB-2 (ERBB2) |
Antigen Info | ||||
| Click to Show/Hide the Sequence Information of This Antibody | ||||||
| Heavy Chain Sequence |
EVQLVESGGGLVQPGGSLRLSCAASGFNIKDTYIHWVRQAPGKGLEWVARIYPTNGYTRY
ADSVKGRFTISADTSKNTAYLQMNSLRAEDTAVYYCSRWGGDGFYAMDYWGQGTLVTVSS ASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSS GLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGG PSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYN STYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREE MTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRW QQGNVFSCSVMHEALHNHYTQKSLSLSPGK Click to Show/Hide
|
|||||
| Light Chain Sequence |
DIQMTQSPSSLSASVGDRVTITCRASQDVNTAVAWYQQKPGKAPKLLIYSASFLYSGVPS
RFSGSRSGTDFTLTISSLQPEDFATYYCQQHYTTPPTFGQGTKVEIKRTVAAPSVFIFPP SDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLT LSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC Click to Show/Hide
|
|||||
Each Antibody-drug Conjugate Related to This Antibody
Full Information of The Activity Data of The ADC(s) Related to This Antibody
GQ1005 [Phase 3]
Identified from the Human Clinical Data
| Experiment 1 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Objective Response Rate (ORR) |
27.60%
|
|||
| Patients Enrolled |
Eligible participants are adults (≥18 years) with advanced/metastatic HER2-expressing solid tumors (IHC 1+/2+/3+ or HER2 mutations) who failed or are intolerant to standard therapy. Key inclusion criteria: ECOG 0-1, adequate organ function, measurable lesions per RECIST 1.1, and washout from prior therapies. Exclusion criteria include uncontrolled brain metastases, cardiovascular disease, significant pulmonary conditions, prior topoisomerase I inhibitor-ADCs, active infections (HIV/HBV/HCV), pregnancy, and unresolved toxicity >Grade 1 from prior treatments.
Click to Show/Hide
|
||||
| Administration Dosage |
GQ1005 will be administered intravenously every 21 days.
|
||||
| Related Clinical Trial | |||||
| NCT Number | NCT06154343 | Clinical Status | PHASE1 | ||
| Clinical Description |
A Phase 1, First-In-Human, Multicenter, Open-Label,Dose-Escalation and Extension Study of GQ1005 in Subjects With HER2-Expressing Advanced Solid Tumors
|
||||
| Primary Endpoint |
The study evaluates the safety and tolerability of GQ1005, including incidence and severity of adverse events (AEs) graded by NCI-CTCAE v5.0, dose-limiting toxicities (DLTs) during the first 21-day cycle, and determination of the maximal tolerance dose (MTD) or recommended phase II dose (RP2D) based on cumulative cohort data.
|
||||
| Other Endpoint |
The pharmacokinetics (PK) of GQ1005 will be assessed via maximum concentration (Cmax), time to peak concentration (Tmax), and area under the curve (AUC). Antitumor efficacy measures include overall response rate (ORR), duration of response (DOR), disease control rate (DCR), time-to-response (TTR), progression-free survival (PFS), and overall survival (OS), all evaluated per RECIST 1.1. Immunogenicity will be assessed by anti-drug antibody (ADA) formation.
Click to Show/Hide
|
||||
| Experiment 2 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Disease control rate (DCR) |
69%
|
|||
| Patients Enrolled |
Eligible participants are adults (≥18 years) with advanced/metastatic HER2-expressing solid tumors (IHC 1+/2+/3+ or HER2 mutations) who failed or are intolerant to standard therapy. Key inclusion criteria: ECOG 0-1, adequate organ function, measurable lesions per RECIST 1.1, and washout from prior therapies. Exclusion criteria include uncontrolled brain metastases, cardiovascular disease, significant pulmonary conditions, prior topoisomerase I inhibitor-ADCs, active infections (HIV/HBV/HCV), pregnancy, and unresolved toxicity >Grade 1 from prior treatments.
Click to Show/Hide
|
||||
| Administration Dosage |
GQ1005 will be administered intravenously every 21 days.
|
||||
| Related Clinical Trial | |||||
| NCT Number | NCT06154343 | Clinical Status | PHASE1 | ||
| Clinical Description |
A Phase 1, First-In-Human, Multicenter, Open-Label,Dose-Escalation and Extension Study of GQ1005 in Subjects With HER2-Expressing Advanced Solid Tumors
|
||||
| Primary Endpoint |
The study evaluates the safety and tolerability of GQ1005, including incidence and severity of adverse events (AEs) graded by NCI-CTCAE v5.0, dose-limiting toxicities (DLTs) during the first 21-day cycle, and determination of the maximal tolerance dose (MTD) or recommended phase II dose (RP2D) based on cumulative cohort data.
|
||||
| Other Endpoint |
The pharmacokinetics (PK) of GQ1005 will be assessed via maximum concentration (Cmax), time to peak concentration (Tmax), and area under the curve (AUC). Antitumor efficacy measures include overall response rate (ORR), duration of response (DOR), disease control rate (DCR), time-to-response (TTR), progression-free survival (PFS), and overall survival (OS), all evaluated per RECIST 1.1. Immunogenicity will be assessed by anti-drug antibody (ADA) formation.
Click to Show/Hide
|
||||
GQ1001 [Phase 1/2]
Identified from the Human Clinical Data
| Experiment 1 Reporting the Activity Date of This ADC | [2] | ||||
| Patients Enrolled |
Eligible patients are HER2+ metastatic breast cancer patients (IHC3+/ISH+, ECOG 0-1, LVEF≥50%) with ≥1 prior trastuzumab-based therapy, measurable lesions, and adequate organ function, excluding those with active CNS metastases, prior DM1-ADC/pyrotinib use (exceptions apply), significant cardiac/ILD history, or uncontrolled infections.
|
||||
| Administration Dosage |
Patients will receive the recommended phase 2 dose of GQ1001 determined in phase I. GQ1001 infusions on day 1 of each 21-day cycle combinate with pyrotinib 320mg orally once daily until disease progression or unacceptable toxicity.
|
||||
| Related Clinical Trial | |||||
| NCT Number | NCT05575804 | Clinical Status | PHASE1|||PHASE2 | ||
| Clinical Description |
Phase Ib/II Study of GQ1001 and Pyrotinib in HER2 Positive Metastatic Breast Cancer Patients Who Had Failed Previous Anti-HER2 Treatment(GRACE)
|
||||
| Primary Endpoint |
The study evaluates dose-limiting toxicities (DLTs) and maximum tolerated dose (MTD) in Phase I (21-day cycles), along with treatment-related adverse events (CTCAE v5.0) and objective response rate (ORR, RECIST 1.1) over 24 months.
|
||||
| Other Endpoint |
Pharmacokinetic parameters (Cmax, Ctrough, AUC) for GQ1001, DM1, pyrotinib, and anti-HER2 antibody are assessed in Phase I, while efficacy outcomes (ORR, DoR, DCR, PFS per RECIST 1.1) are tracked across both phases for 24 months.
|
||||
| Experiment 2 Reporting the Activity Date of This ADC | [3] | ||||
| Patients Enrolled |
Eligible patients are adults (≥18) with HER2+ advanced/metastatic solid tumors (breast, gastric/GEJ, or other) refractory to standard therapy, ECOG 0-1, LVEF≥50%, and adequate organ function, excluding those with active brain metastases, significant cardiac/pulmonary disease, unresolved toxicities (>Grade 1), uncontrolled infections, or prior cumulative anthracycline dose >360mg/m2 doxorubicin-equivalent.
Click to Show/Hide
|
||||
| Administration Dosage |
GQ1001 will be administered intravenously every 21 days. Dose Escalation will be guided by a modified 3+3 design.
|
||||
| Related Clinical Trial | |||||
| NCT Number | NCT04450732 | Clinical Status | PHASE1 | ||
| Clinical Description |
A Phase 1, First-In-Human, Multicenter, Open-Label, Study of GQ1001, a HER2 Targeted Antibody-Drug Conjugate, Administered Intravenously, in Adult Patients With HER2-Positive Advanced Solid Tumors
|
||||
| Primary Endpoint |
The study evaluates dose-limiting toxicities (DLTs) and determines maximum tolerated dose (MTD) or recommended expansion dose (DRDE) during the first 21-day cycle, with adverse events assessed per NCI CTCAE v5.0 criteria.
|
||||
| Other Endpoint |
Safety assessments include AE monitoring, lab abnormalities, and pharmacokinetic parameters (AUC, Cmax, Tmax, T1/2, MRT, Vd) of GQ1001, along with efficacy outcomes (ORR, DCR, DoR, PFS per RECIST 1.1) and immunogenicity (anti-drug antibodies) over approximately 1 year.
|
||||
| Experiment 3 Reporting the Activity Date of This ADC | [4] | ||||
| Efficacy Data | Partial Response (PR) |
40%
|
|||
| Patients Enrolled |
HER2-positive advanced solid tumors.
|
||||
| Administration Dosage |
Administered intravenously as a monotherapy on Day 1 of 21-day cycles. The starting dose was 1.20 mg/kg, followed by 2.40, 3.60, 4.80, 6.00, 7.20 and 8.40 mg/kg.
|
||||
| Related Clinical Trial | |||||
| NCT Number | NCT04450732 | Clinical Status | Phase 1 | ||
| Clinical Description |
A phase 1, first-in-human, multicenter, open-label, study of GQ1001, a HER2 targeted antibody-drug conjugate, administered intravenously, in adult patients with HER2-positive advanced solid tumors.
|
||||
| Experiment 4 Reporting the Activity Date of This ADC | [5] | ||||
| Related Clinical Trial | |||||
| NCT Number | NCT05575804 | Clinical Status | Phase 1/2 | ||
| Clinical Description |
Phase 1b/2 study of GQ1001 and pyrotinib in HER2 positive metastatic breast cancer patients who had failed previous anti-HER2 treatment GRACE.
|
||||
ALT-P7 [Phase 1 (discontinued)]
Identified from the Human Clinical Data
| Experiment 1 Reporting the Activity Date of This ADC | [6] | ||||
| Efficacy Data | Progression Free Survival |
6.2 months
|
|||
| Patients Enrolled |
Eligible patients must be ≥19 years old with ECOG 0-1, adequate organ function (hematologic/renal/hepatic), and negative pregnancy status. Key exclusions include trastuzumab intolerance, active CNS metastases, unresolved Grade ≥2 toxicities, recent anticancer therapies (<3 weeks), significant cardiopulmonary dysfunction (LVEF<50%, NYHA II-IV), active infections (HIV/HBV/HCV), or other malignancies within 5 years (except specified cured cancers).
Click to Show/Hide
|
||||
| Administration Dosage |
8 groups: 0.3 mg/kg, 0.6 mg/kg, 1.2 mg/kg, 2.4 mg/kg, 3.6 mg/kg, 4.2 mg/kg, 4.5 mg/kg, 4.8 mg/kg, Administration: Day 1 of each 3-week cycle
|
||||
| Related Clinical Trial | |||||
| NCT Number | NCT03281824 | Clinical Status | PHASE1 | ||
| Clinical Description |
Open-Label, Dose Increase and Phase I Study of ALT-P7 to Determine Safety, Tolerability, Pharmacokinetics for HER2 Positive Metastatic Breast Cancer Patients Who Have Progressed on Previous Trastuzumab-Based Therapy
|
||||
| Primary Endpoint |
The study evaluates safety endpoints including dose-limiting toxicities (DLTs) during the 21-day assessment period to determine maximum tolerated dose (MTD) or recommended phase II dose (RP2D), along with treatment-emergent adverse events (TEAEs) graded by CTCAE v4.03 with special focus on immune-related adverse events (irAEs) monitored for up to 4 weeks post-treatment.
Click to Show/Hide
|
||||
| Other Endpoint |
Pharmacokinetic analysis assesses ALT-P7 metabolism across dose groups (1.2-5.4 mg/kg) from administration to elimination, while immunogenicity testing evaluates anti-drug antibody responses. Efficacy outcomes are analyzed descriptively after Cycle 2 (42 days), including subject counts, means, standard deviations, and ranges for each dose cohort.
|
||||
| Experiment 2 Reporting the Activity Date of This ADC | [6] | ||||
| Efficacy Data | Disease control rate (DCR) |
77.30%
|
|||
| Patients Enrolled |
Eligible patients must be ≥19 years old with ECOG 0-1, adequate organ function (hematologic/renal/hepatic), and negative pregnancy status. Key exclusions include trastuzumab intolerance, active CNS metastases, unresolved Grade ≥2 toxicities, recent anticancer therapies (<3 weeks), significant cardiopulmonary dysfunction (LVEF<50%, NYHA II-IV), active infections (HIV/HBV/HCV), or other malignancies within 5 years (except specified cured cancers).
Click to Show/Hide
|
||||
| Administration Dosage |
8 groups: 0.3 mg/kg, 0.6 mg/kg, 1.2 mg/kg, 2.4 mg/kg, 3.6 mg/kg, 4.2 mg/kg, 4.5 mg/kg, 4.8 mg/kg, Administration: Day 1 of each 3-week cycle
|
||||
| Related Clinical Trial | |||||
| NCT Number | NCT03281824 | Clinical Status | PHASE1 | ||
| Clinical Description |
Open-Label, Dose Increase and Phase I Study of ALT-P7 to Determine Safety, Tolerability, Pharmacokinetics for HER2 Positive Metastatic Breast Cancer Patients Who Have Progressed on Previous Trastuzumab-Based Therapy
|
||||
| Primary Endpoint |
The study evaluates safety endpoints including dose-limiting toxicities (DLTs) during the 21-day assessment period to determine maximum tolerated dose (MTD) or recommended phase II dose (RP2D), along with treatment-emergent adverse events (TEAEs) graded by CTCAE v4.03 with special focus on immune-related adverse events (irAEs) monitored for up to 4 weeks post-treatment.
Click to Show/Hide
|
||||
| Other Endpoint |
Pharmacokinetic analysis assesses ALT-P7 metabolism across dose groups (1.2-5.4 mg/kg) from administration to elimination, while immunogenicity testing evaluates anti-drug antibody responses. Efficacy outcomes are analyzed descriptively after Cycle 2 (42 days), including subject counts, means, standard deviations, and ranges for each dose cohort.
|
||||
| Experiment 3 Reporting the Activity Date of This ADC | [8] | ||||
| Efficacy Data | Objective Response Rate (ORR) |
13.30%
|
|||
| Patients Enrolled |
Patients with HER2-positive advanced breast cancer progressive to at least two kinds of prior anti-HER2 treatment.
|
||||
| Administration Dosage |
0.30-4.80 mg/kg iv administered once every 3 weeks.
|
||||
| Related Clinical Trial | |||||
| NCT Number | NCT03281824 | Clinical Status | Phase 1 | ||
| Clinical Description |
Open-label, dose increase and phase 1 study of ALT-P7 to determine safety, tolerability, pharmacokinetics for HER2 positive metastatic breast cancer patients who have progressed on previous trastuzumab-based therapy.
|
||||
ADCT-502 [Phase 1 (discontinued)]
Identified from the Human Clinical Data
| Experiment 1 Reporting the Activity Date of This ADC | [7] | ||||
| Patients Enrolled |
Key eligibility: Adults (≥18) with HER2+ metastatic solid tumors, ECOG 0-2 (dose escalation)/0-1 (expansion), adequate organ function (ANC≥1500, platelets≥100K, bilirubin≤1.5×ULN, CrCl≥60). Exclusions: Grade≥3 antibody hypersensitivity, CNS metastases, active HBV/HCV/HIV, recent anticancer therapy, pregnancy, or uncontrolled comorbidities.
Click to Show/Hide
|
||||
| Administration Dosage |
Part 1 (dose escalation): Participants received an infusion of ADCT-502, at escalating doses. Part 1 continued until the maximum tolerated dose or the recommended dose (s) and schedule (s) for expansion were determined.Part 2 (expansion): Participants were due to be assigned to the recommended dose level of ADCT-502 as identified in Part 1 by the Dose Escalation Steering Committee.
Click to Show/Hide
|
||||
| Related Clinical Trial | |||||
| NCT Number | NCT03125200 | Clinical Status | PHASE1 | ||
| Clinical Description |
A Phase 1, Open-Label, Dose-Escalation Study to Evaluate the Safety, Tolerability, Pharmacokinetics, and Antitumor Activity of ADCT-502 in Patients With Advanced Solid Tumors With HER2 Expression
|
||||
| Primary Endpoint |
Primary endpoints include DLT assessment (Grade ≥3 per CTCAE v4) during first 21-day cycle, TEAE/SAE monitoring through treatment +30 days, and comprehensive safety evaluations (labs, physical exams, ECOG status, vitals, ECG).
|
||||
| Other Endpoint |
Secondary objectives cover tumor response (ORR/DCR/DOR/PFS/OS assessed q12w per RECIST 1.1), PK analysis (AUC/Cmax/Tmax for total antibody, DAR≥0 species, PBD-conjugated antibody, free warhead SG3199), and immunogenicity (ADA titers).
|
||||
| Experiment 2 Reporting the Activity Date of This ADC | [9] | ||||
| Efficacy Data | Objective Response Rate (ORR) |
20%
|
|||
| Patients Enrolled |
Patients with HER2-positive advanced solid tumors.
|
||||
| Administration Dosage |
Seven dose cohorts (30, 60, 120, 150, 180, 210, 240 ug/kg on day 1, iv once every 3 weeks.
|
||||
| Related Clinical Trial | |||||
| NCT Number | NCT03125200 | Clinical Status | Phase 1 | ||
| Clinical Description |
A phase 1, open-label, dose-escalation study to evaluate the safety, tolerability, pharmacokinetics, and antitumor activity of ADCT-502 in patients with advanced solid tumors with HER2 expression.
|
||||
References
