Antigen Information
General Information of This Antigen
| Antigen ID | TAR0ZYPEF |
|||||
|---|---|---|---|---|---|---|
| Antigen Name | C-C chemokine receptor type 7 (CCR7) |
|||||
| Gene Name | CCR7 |
|||||
| Gene ID | ||||||
| Synonym | CMKBR7; EBI1; EVI1; BLR2;CDw197;Epstein-Barr virus-induced G-protein coupled receptor 1;MIP-3 beta receptor;CD_antigen=CD197 |
|||||
| Sequence |
MDLGKPMKSVLVVALLVIFQVCLCQDEVTDDYIGDNTTVDYTLFESLCSKKDVRNFKAWF
LPIMYSIICFVGLLGNGLVVLTYIYFKRLKTMTDTYLLNLAVADILFLLTLPFWAYSAAK SWVFGVHFCKLIFAIYKMSFFSGMLLLLCISIDRYVAIVQAVSAHRHRARVLLISKLSCV GIWILATVLSIPELLYSDLQRSSSEQAMRCSLITEHVEAFITIQVAQMVIGFLVPLLAMS FCYLVIIRTLLQARNFERNKAIKVIIAVVVVFIVFQLPYNGVVLAQTVANFNITSSTCEL SKQLNIAYDVTYSLACVRCCVNPFLYAFIGVKFRNDLFKLFKDLGCLSQEQLRQWSSCRH IRRSSMSVEAETTTTFSP Click to Show/Hide
|
|||||
| Family | G-protein coupled receptor 1 family |
|||||
| Function |
Receptor for the MIP-3-beta chemokine. Probable mediator of EBV effects on B-lymphocytes or of normal lymphocyte functions.
Click to Show/Hide
|
|||||
| Uniprot Entry | ||||||
| HGNC ID | ||||||
| KEGG ID | ||||||
Each Antibody-drug Conjuate AND It's Component Related to This Antigen
Full List of The ADC Related to This Antigen
A humanized Fc-silenced anti-CCR7 IgG1 antibody
| ADC Info | ADC Name | Payload | Target | Linker | Ref |
|---|---|---|---|---|---|
JBH-492 |
Mertansine DM4 |
Microtubule (MT) |
A cleavable linker |
[1] |
Anti-CCR7 mAb 121G12
| ADC Info | ADC Name | Payload | Target | Linker | Ref |
|---|---|---|---|---|---|
Ab-MBT-DM4 |
Ab-MBT.DM4 payload |
Undisclosed |
Ab-MBT.DM4 linker |
[2] | |
Ab-MBT-DM4 |
Ab-MBT-DM4 payload |
Undisclosed |
Ab-MBT-DM4 linker |
[2] | |
Ab-MPET-DM4 |
Ab-MPET-DM4 payload |
Undisclosed |
Ab-MPET-DM4 linker |
[2] | |
Ab-MPET-DM4 |
Ab-MPET-DM4 payload |
Undisclosed |
Ab-MPET-DM4 linker |
[2] | |
121G12-CysMab-AURIX1 |
121G12.CysMab.AURIX1 payload |
Undisclosed |
121G12.CysMab.AURIX1 linker |
[2] | |
121G12-CysMab-DAPA-AURIX1 |
121G12.CysMab.DAPA.AURIX1 payload |
Undisclosed |
121G12.CysMab.DAPA.AURIX1 linker |
[2] | |
121G12-CysMab-DAPA-MPET-DM4 |
121G12.CysMab.DAPA.MPET.DM4 payload |
Undisclosed |
121G12.CysMab.DAPA.MPET.DM4 linker |
[2] | |
121G12-DAPA-sSPDB-DM4 |
121G12.DAPA.sSPDB.DM4 payload |
Undisclosed |
121G12.DAPA.sSPDB.DM4 linker |
[2] | |
Ab-CX1-1-DM1 |
Ab-CX1-1-DM1 payload |
Undisclosed |
Ab-CX1-1-DM1 linker |
[2] | |
Ab-MCC-DM1 |
Ab-MCC-DM1 payload |
Undisclosed |
Ab-MCC-DM1 linker |
[2] | |
Ab-MEPET-DM1 |
Ab-MEPET-DM1 payload |
Undisclosed |
Ab-MEPET-DM1 linker |
[2] | |
Ab-MEPET-DM3 |
Ab.MEPET.DM3 payload |
Undisclosed |
Ab.MEPET.DM3 linker |
[2] | |
Ab-MEPET-DM4 |
Ab-MEPET-DM4 payload |
Undisclosed |
Ab-MEPET-DM4 linker |
[2] | |
Ab-MPET-DM1 |
Ab-MPET-DM1 payload |
Undisclosed |
Ab-MPET-DM1 linker |
[2] | |
Ab-SPDB-DM4 |
Ab-SPDB-DM4 payload |
Undisclosed |
Ab-SPDB-DM4 linker |
[2] | |
Ab-sSPDB-DM4 |
Ab-sSPDB-DM4 payload |
Undisclosed |
Ab-sSPDB-DM4 linker |
[2] |
Anti-CCR7 mAb 506E15
| ADC Info | ADC Name | Payload | Target | Linker | Ref |
|---|---|---|---|---|---|
506E15-AURIX1 |
506E15.AURIX1 payload |
Undisclosed |
506E15.AURIX1 linker |
[2] | |
506E15-CysMab-AURIX1 |
506E15.CysMab.AURIX1 payload |
Undisclosed |
506E15.CysMab.AURIX1 linker |
[2] | |
506E15-CysMab-DAPA-AURIX2 |
506E15.CysMab.DAPA.AURIX2 payload |
Undisclosed |
506E15.CysMab.DAPA.AURIX2 linker |
[2] |
Anti-CCR7 mAb 674J13
| ADC Info | ADC Name | Payload | Target | Linker | Ref |
|---|---|---|---|---|---|
674J13-CysMab-AURIX1 |
674J13.CysMab.AURIX1 payload |
Undisclosed |
674J13.CysMab.AURIX1 linker |
[2] | |
674J13-CysMab-DAPA-AURIX2 |
674J13.CysMab.DAPA.AURIX2 payload |
Undisclosed |
674J13.CysMab.DAPA.AURIX2 linker |
[2] |
Anti-CCR7 mAb 684E12
| ADC Info | ADC Name | Payload | Target | Linker | Ref |
|---|---|---|---|---|---|
684E12-SMCC-DM1 |
684E12.SMCC.DM1 payload |
Undisclosed |
684E12.SMCC.DM1 linker |
[2] |
Tissue/Disease specific Abundances of This Antigen
Tissue specific Abundances of This Antigen
ICD Disease Classification 01
Bacterial infection [ICD-11: 1A00-1C4Z]
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Gingival | |
| The Specific Disease | Bacterial infection of gingival | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 3.03E-09; Fold-change: 0.822390188; Z-score: 1.093237842 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
ICD Disease Classification 02
Brain cancer [ICD-11: 2A00]
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Brainstem | |
| The Specific Disease | Glioma | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.836797266; Fold-change: -0.114328011; Z-score: -0.357471638 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
| The Studied Tissue | White matter | |
| The Specific Disease | Glioma | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.070349351; Fold-change: 1.145662595; Z-score: 0.890454857 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
| The Studied Tissue | Brainstem | |
| The Specific Disease | Neuroectodermal tumor | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.003384773; Fold-change: -0.573515315; Z-score: -1.11563654 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
| The Studied Tissue | Nervous | |
| The Specific Disease | Brain cancer | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 5.64E-06; Fold-change: 0.030475703; Z-score: 0.095259214 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
Chronic myeloid leukemia [ICD-11: 2A20]
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Whole blood | |
| The Specific Disease | Polycythemia vera | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 2.84E-07; Fold-change: -0.405899356; Z-score: -0.996998022 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
| The Studied Tissue | Whole blood | |
| The Specific Disease | Myelofibrosis | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.003783333; Fold-change: -0.885809509; Z-score: -2.187396891 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
MyeloDysplastic syndromes [ICD-11: 2A37]
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Bone marrow | |
| The Specific Disease | Myelodysplastic syndromes | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.011577401; Fold-change: -0.298239686; Z-score: -0.306265902 | |
| The Expression Level of Disease Section Compare with the Adjacent Tissue | p-value: 0.00210138; Fold-change: -5.067752984; Z-score: -4.623280143 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
Lymphoma [ICD-11: 2A90- 2A85]
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Tonsil | |
| The Specific Disease | Lymphoma | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.660459955; Fold-change: -0.271866148; Z-score: -0.354591186 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
Gastric cancer [ICD-11: 2B72]
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Gastric | |
| The Specific Disease | Gastric cancer | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.640088096; Fold-change: 0.351574297; Z-score: 0.530509167 | |
| The Expression Level of Disease Section Compare with the Adjacent Tissue | p-value: 0.249358788; Fold-change: -0.244215327; Z-score: -0.199565157 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
Colon cancer [ICD-11: 2B90]
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Colon | |
| The Specific Disease | Colon cancer | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 4.53E-07; Fold-change: -0.410086068; Z-score: -0.344958241 | |
| The Expression Level of Disease Section Compare with the Adjacent Tissue | p-value: 0.013470762; Fold-change: -0.088869107; Z-score: -0.086847891 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
Pancreatic cancer [ICD-11: 2C10]
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Pancreas | |
| The Specific Disease | Pancreatic cancer | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.749795907; Fold-change: 0.610129372; Z-score: 0.329367752 | |
| The Expression Level of Disease Section Compare with the Adjacent Tissue | p-value: 0.60213215; Fold-change: 0.427406497; Z-score: 0.247778189 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
Liver cancer [ICD-11: 2C12]
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Liver | |
| The Specific Disease | Liver cancer | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.000394808; Fold-change: 0.088795848; Z-score: 0.239868363 | |
| The Expression Level of Disease Section Compare with the Adjacent Tissue | p-value: 2.20E-09; Fold-change: -0.598745671; Z-score: -0.868616686 | |
| The Expression Level of Disease Section Compare with the Other Disease Section | p-value: 0.482321634; Fold-change: 0.391460425; Z-score: 0.507192605 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
Lung cancer [ICD-11: 2C25]
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Lung | |
| The Specific Disease | Lung cancer | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.101202723; Fold-change: 0.210419811; Z-score: 0.238958915 | |
| The Expression Level of Disease Section Compare with the Adjacent Tissue | p-value: 0.055535927; Fold-change: 0.146379929; Z-score: 0.192077834 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
Melanoma [ICD-11: 2C30]
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Skin | |
| The Specific Disease | Melanoma | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.000411705; Fold-change: 0.524179514; Z-score: 0.80870081 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
Sarcoma [ICD-11: 2C35]
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Muscle | |
| The Specific Disease | Sarcoma | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 5.18E-18; Fold-change: 0.150987696; Z-score: 0.438780556 | |
| The Expression Level of Disease Section Compare with the Adjacent Tissue | p-value: 0.591999287; Fold-change: -0.215437158; Z-score: -0.768167341 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
Breast cancer [ICD-11: 2C60]
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Breast | |
| The Specific Disease | Breast cancer | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 1.73E-58; Fold-change: 0.619159153; Z-score: 1.03379272 | |
| The Expression Level of Disease Section Compare with the Adjacent Tissue | p-value: 0.001015074; Fold-change: 0.525461035; Z-score: 0.499448234 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
Ovarian cancer [ICD-11: 2C73]
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Ovarian | |
| The Specific Disease | Ovarian cancer | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.40698974; Fold-change: 0.07433485; Z-score: 0.124012944 | |
| The Expression Level of Disease Section Compare with the Adjacent Tissue | p-value: 0.411687393; Fold-change: 0.261606658; Z-score: 0.392345736 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
Cervical cancer [ICD-11: 2C77]
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Cervical | |
| The Specific Disease | Cervical cancer | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.055608272; Fold-change: 0.553487718; Z-score: 0.480964658 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
Uterine cancer [ICD-11: 2C78]
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Endometrium | |
| The Specific Disease | Uterine cancer | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 1.73E-08; Fold-change: 0.389580499; Z-score: 0.456008776 | |
| The Expression Level of Disease Section Compare with the Adjacent Tissue | p-value: 1.77E-11; Fold-change: 1.223737263; Z-score: 8.292069426 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
Prostate cancer [ICD-11: 2C82]
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Prostate | |
| The Specific Disease | Prostate cancer | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.62609396; Fold-change: -0.036648155; Z-score: -0.028503184 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
Bladder cancer [ICD-11: 2C94]
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Bladder | |
| The Specific Disease | Bladder cancer | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.000430287; Fold-change: 1.1786589; Z-score: 1.97226336 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
Retina cancer [ICD-11: 2D02]
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Uvea | |
| The Specific Disease | Retinoblastoma tumor | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.264596051; Fold-change: -0.08395561; Z-score: -0.61006567 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
Thyroid cancer [ICD-11: 2D10]
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Thyroid | |
| The Specific Disease | Thyroid cancer | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.473205341; Fold-change: 0.466683757; Z-score: 0.218774951 | |
| The Expression Level of Disease Section Compare with the Adjacent Tissue | p-value: 0.281513858; Fold-change: 0.315738727; Z-score: 0.212712685 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
Adrenal cancer [ICD-11: 2D11]
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Adrenal cortex | |
| The Specific Disease | Adrenocortical carcinoma | |
| The Expression Level of Disease Section Compare with the Other Disease Section | p-value: 0.936837252; Fold-change: -0.058128584; Z-score: -0.345050035 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
Head and neck cancer [ICD-11: 2D42]
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Head and neck | |
| The Specific Disease | Head and neck cancer | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 8.74E-12; Fold-change: 2.12057767; Z-score: 1.279682935 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
Pituitary cancer [ICD-11: 2F37]
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Pituitary | |
| The Specific Disease | Pituitary gonadotrope tumor | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.073161173; Fold-change: -0.149751689; Z-score: -0.51433026 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
| The Studied Tissue | Pituitary | |
| The Specific Disease | Pituitary cancer | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.199683838; Fold-change: 0.096876445; Z-score: 0.446461026 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
ICD Disease Classification 03
Thrombocytopenia [ICD-11: 3B64]
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Whole blood | |
| The Specific Disease | Thrombocytopenia | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.870972402; Fold-change: 0.191171004; Z-score: 0.199126804 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
ICD Disease Classification 04
Lupus erythematosus [ICD-11: 4A40]
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Whole blood | |
| The Specific Disease | Lupus erythematosus | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 5.59E-09; Fold-change: -0.416700378; Z-score: -0.617801713 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
Autoimmune disease [ICD-11: 4A4Z]
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Peripheral monocyte | |
| The Specific Disease | Autoimmune uveitis | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.644831114; Fold-change: 0.336908315; Z-score: 0.427434398 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
ICD Disease Classification 05
Hyperlipoproteinaemia [ICD-11: 5C80]
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Whole blood | |
| The Specific Disease | Familial hypercholesterolemia | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 4.84E-12; Fold-change: -4.129686903; Z-score: -1.969835696 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
ICD Disease Classification 06
Schizophrenia [ICD-11: 6A20]
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Superior temporal cortex | |
| The Specific Disease | Schizophrenia | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.879725747; Fold-change: -0.013003412; Z-score: -0.084372089 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
ICD Disease Classification 08
Multiple sclerosis [ICD-11: 8A40]
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Spinal cord | |
| The Specific Disease | Multiple sclerosis | |
| The Expression Level of Disease Section Compare with the Adjacent Tissue | p-value: 0.711437166; Fold-change: -0.05349261; Z-score: -0.208608423 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
| The Studied Tissue | Plasmacytoid dendritic cells | |
| The Specific Disease | Multiple sclerosis | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.588387414; Fold-change: -0.016630926; Z-score: -0.05824276 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
Epilepsy [ICD-11: 8A60]
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Peritumoral cortex | |
| The Specific Disease | Epilepsy | |
| The Expression Level of Disease Section Compare with the Other Disease Section | p-value: 0.499552298; Fold-change: 0.062821451; Z-score: 0.279414769 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
Cerebral ischaemic stroke [ICD-11: 8B11]
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Whole blood | |
| The Specific Disease | Cardioembolic Stroke | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 3.57E-11; Fold-change: -0.954169647; Z-score: -2.176073663 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
| The Studied Tissue | Peripheral blood | |
| The Specific Disease | Ischemic stroke | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.808521894; Fold-change: -0.063548595; Z-score: -0.089263998 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
ICD Disease Classification 1
HIV [ICD-11: 1C60-1C62]
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | White matter | |
| The Specific Disease | HIV | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.243853471; Fold-change: -0.166857368; Z-score: -0.558027784 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
Influenza [ICD-11: 1E30]
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Whole blood | |
| The Specific Disease | Influenza | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.804489011; Fold-change: -0.342419643; Z-score: -0.718344366 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
Chronic hepatitis C [ICD-11: 1E51.1]
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Whole blood | |
| The Specific Disease | Chronic hepatitis C | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.46279053; Fold-change: 0.282255058; Z-score: 0.565608148 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
Sepsis [ICD-11: 1G40-1G41]
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Whole blood | |
| The Specific Disease | Sepsis | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 9.03E-27; Fold-change: -1.921246558; Z-score: -2.598078622 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
Septic shock [ICD-11: 1G41]
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Whole blood | |
| The Specific Disease | Septic shock | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 3.01E-52; Fold-change: -1.203277715; Z-score: -1.635300558 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
Pediatric respiratory syncytial virus infection [ICD-11: CA40.11]
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Peripheral blood | |
| The Specific Disease | Pediatric respiratory syncytial virus infection | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.003124159; Fold-change: -0.33124182; Z-score: -1.417564296 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
ICD Disease Classification 11
Essential hypertension [ICD-11: BA00]
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Peripheral blood | |
| The Specific Disease | Essential hypertension | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.157892717; Fold-change: -0.467599482; Z-score: -0.867836706 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
Myocardial infarction [ICD-11: BA41]
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Peripheral blood | |
| The Specific Disease | Myocardial infarction | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.142436868; Fold-change: 0.021589428; Z-score: 0.030938128 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
Coronary artery disease [ICD-11: BA8Z]
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Peripheral blood | |
| The Specific Disease | Coronary artery disease | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.78541026; Fold-change: 0.205744907; Z-score: 0.118257124 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
Aortic stenosis [ICD-11: BB70]
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Calcified aortic valve | |
| The Specific Disease | Aortic stenosis | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.148959194; Fold-change: 0.275890502; Z-score: 0.591870749 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
Arteriosclerosis [ICD-11: BD40]
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Peripheral blood | |
| The Specific Disease | Arteriosclerosis | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.142559887; Fold-change: 0.230364753; Z-score: 0.415314337 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
Aneurysm [ICD-11: BD50]
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Intracranial artery | |
| The Specific Disease | Aneurysm | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.189751339; Fold-change: 0.50020393; Z-score: 1.891462022 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
ICD Disease Classification 12
Immunodeficiency [ICD-11: 4A00-4A20]
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Peripheral blood | |
| The Specific Disease | Immunodeficiency | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.090484419; Fold-change: -0.133276149; Z-score: -0.695914432 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
Apnea [ICD-11: 7A40]
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Hyperplastic tonsil | |
| The Specific Disease | Apnea | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.274071643; Fold-change: 0.598463806; Z-score: 2.171920158 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
Olive pollen allergy [ICD-11: CA08.00]
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Peripheral blood | |
| The Specific Disease | Olive pollen allergy | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.337016069; Fold-change: -0.192237461; Z-score: -0.245727894 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
Chronic rhinosinusitis [ICD-11: CA0A]
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Sinus mucosa | |
| The Specific Disease | Chronic rhinosinusitis | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.162618631; Fold-change: 0.348441982; Z-score: 1.047885386 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
Chronic obstructive pulmonary disease [ICD-11: CA22]
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Lung | |
| The Specific Disease | Chronic obstructive pulmonary disease | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.195850603; Fold-change: 0.278400937; Z-score: 0.441188201 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
| The Studied Tissue | Small airway epithelium | |
| The Specific Disease | Chronic obstructive pulmonary disease | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.251056312; Fold-change: 0.116090157; Z-score: 0.30764242 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
Asthma [ICD-11: CA23]
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Nasal and bronchial airway | |
| The Specific Disease | Asthma | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.530732783; Fold-change: -0.038799203; Z-score: -0.075724197 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
Human rhinovirus infection [ICD-11: CA42]
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Nasal Epithelium | |
| The Specific Disease | Human rhinovirus infection | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.000471551; Fold-change: 0.176360358; Z-score: 0.614862483 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
Idiopathic pulmonary fibrosis [ICD-11: CB03.4]
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Lung | |
| The Specific Disease | Idiopathic pulmonary fibrosis | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.016277429; Fold-change: 0.797817287; Z-score: 1.496498777 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
ICD Disease Classification 13
Periodontal disease [ICD-11: DA0C]
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Gingival | |
| The Specific Disease | Periodontal disease | |
| The Expression Level of Disease Section Compare with the Adjacent Tissue | p-value: 8.08E-09; Fold-change: 0.800692276; Z-score: 1.072650769 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
Eosinophilic gastritis [ICD-11: DA42.2]
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Gastric antrum | |
| The Specific Disease | Eosinophilic gastritis | |
| The Expression Level of Disease Section Compare with the Adjacent Tissue | p-value: 0.549229684; Fold-change: 0.035051601; Z-score: 0.088369097 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
Liver failure [ICD-11: DB99.7-DB99.8]
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Liver | |
| The Specific Disease | Liver failure | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 2.70E-07; Fold-change: 1.342442438; Z-score: 4.364129831 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
Ulcerative colitis [ICD-11: DD71]
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Colon mucosal | |
| The Specific Disease | Ulcerative colitis | |
| The Expression Level of Disease Section Compare with the Adjacent Tissue | p-value: 9.15E-08; Fold-change: 0.972182397; Z-score: 2.122253173 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
Irritable bowel syndrome [ICD-11: DD91.0]
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Rectal colon | |
| The Specific Disease | Irritable bowel syndrome | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.623220272; Fold-change: -0.046679577; Z-score: -0.062630882 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
ICD Disease Classification 14
Atopic dermatitis [ICD-11: EA80]
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Skin | |
| The Specific Disease | Atopic dermatitis | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 3.37E-06; Fold-change: 0.970142044; Z-score: 2.538663088 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
Psoriasis [ICD-11: EA90]
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Skin | |
| The Specific Disease | Psoriasis | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 2.92E-39; Fold-change: 1.070939905; Z-score: 2.569247608 | |
| The Expression Level of Disease Section Compare with the Adjacent Tissue | p-value: 9.31E-37; Fold-change: 1.235943951; Z-score: 2.483222201 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
Vitiligo [ICD-11: ED63.0]
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Skin | |
| The Specific Disease | Vitiligo | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.697751797; Fold-change: -0.053900244; Z-score: -0.068388758 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
Alopecia [ICD-11: ED70]
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Skin from scalp | |
| The Specific Disease | Alopecia | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 9.36E-07; Fold-change: 0.442309953; Z-score: 0.772968586 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
Sensitive skin [ICD-11: EK0Z]
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Skin | |
| The Specific Disease | Sensitive skin | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.506992133; Fold-change: 0.682974857; Z-score: 0.585158122 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
ICD Disease Classification 15
Osteoarthritis [ICD-11: FA00-FA0Z]
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Synovial | |
| The Specific Disease | Osteoarthritis | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.904454349; Fold-change: -0.026649829; Z-score: -0.058451913 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
Arthropathy [ICD-11: FA00-FA5Z]
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Peripheral blood | |
| The Specific Disease | Arthropathy | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.116773017; Fold-change: -0.361541234; Z-score: -0.894492809 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
Arthritis [ICD-11: FA20]
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Peripheral blood | |
| The Specific Disease | Arthritis | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 3.61E-05; Fold-change: -0.613203206; Z-score: -0.820316149 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
Rheumatoid arthritis [ICD-11: FA20]
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Synovial | |
| The Specific Disease | Rheumatoid arthritis | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.073227845; Fold-change: 0.347636544; Z-score: 0.779196574 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
Ankylosing spondylitis [ICD-11: FA92.0Z]
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Pheripheral blood | |
| The Specific Disease | Ankylosing spondylitis | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.039783497; Fold-change: -1.106496034; Z-score: -2.010709948 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
Osteoporosis [ICD-11: FB83]
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Bone marrow | |
| The Specific Disease | Osteoporosis | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.233153983; Fold-change: 0.014492002; Z-score: 0.066507851 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
ICD Disease Classification 16
Endometriosis [ICD-11: GA10]
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Endometrium | |
| The Specific Disease | Endometriosis | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.086764215; Fold-change: 0.243020158; Z-score: 0.562909636 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
Interstitial cystitis [ICD-11: GC00.3]
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Bladder | |
| The Specific Disease | Interstitial cystitis | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 3.59E-05; Fold-change: 2.798276535; Z-score: 4.425167178 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
ICD Disease Classification 19
Preterm birth [ICD-11: KA21.4Z]
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Myometrium | |
| The Specific Disease | Preterm birth | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.023438475; Fold-change: -0.89648107; Z-score: -1.21064476 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
ICD Disease Classification 2
Acute myelocytic leukemia [ICD-11: 2A60]
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Bone marrow | |
| The Specific Disease | Acute myelocytic leukemia | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 2.84E-31; Fold-change: -2.228438108; Z-score: -1.594771179 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
Myeloma [ICD-11: 2A83]
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Bone marrow | |
| The Specific Disease | Myeloma | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.001277145; Fold-change: -0.59355581; Z-score: -2.099656228 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
| The Studied Tissue | Peripheral blood | |
| The Specific Disease | Myeloma | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.797258331; Fold-change: -0.095686359; Z-score: -0.182839358 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
Oral cancer [ICD-11: 2B6E]
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Oral | |
| The Specific Disease | Oral cancer | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.000284066; Fold-change: 0.676917587; Z-score: 0.719278116 | |
| The Expression Level of Disease Section Compare with the Adjacent Tissue | p-value: 2.77E-07; Fold-change: 0.654643306; Z-score: 0.776569134 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
Esophagal cancer [ICD-11: 2B70]
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Esophagus | |
| The Specific Disease | Esophagal cancer | |
| The Expression Level of Disease Section Compare with the Adjacent Tissue | p-value: 0.373381611; Fold-change: -1.787050376; Z-score: -1.191603325 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
Rectal cancer [ICD-11: 2B92]
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Rectal colon | |
| The Specific Disease | Rectal cancer | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.461488316; Fold-change: -0.270763164; Z-score: -0.262125395 | |
| The Expression Level of Disease Section Compare with the Adjacent Tissue | p-value: 0.120336787; Fold-change: -0.512929814; Z-score: -0.576393975 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
Skin cancer [ICD-11: 2C30-2C3Z]
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Skin | |
| The Specific Disease | Skin cancer | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 1.46E-24; Fold-change: 0.512102185; Z-score: 0.967277058 | |
| The Expression Level of Disease Section Compare with the Adjacent Tissue | p-value: 1.77E-28; Fold-change: 0.707760069; Z-score: 1.180725582 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
Renal cancer [ICD-11: 2C90-2C91]
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Kidney | |
| The Specific Disease | Renal cancer | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.000209687; Fold-change: 0.31009177; Z-score: 0.886290543 | |
| The Expression Level of Disease Section Compare with the Adjacent Tissue | p-value: 3.48E-05; Fold-change: 0.225568723; Z-score: 0.39150101 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
Ureter cancer [ICD-11: 2C92]
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Urothelium | |
| The Specific Disease | Ureter cancer | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.055153729; Fold-change: 0.085867373; Z-score: 0.201562888 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
ICD Disease Classification 20
Simpson golabi behmel syndrome [ICD-11: LD2C]
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Adipose | |
| The Specific Disease | Simpson golabi behmel syndrome | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.606935893; Fold-change: -0.027273472; Z-score: -0.298089354 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
Tuberous sclerosis complex [ICD-11: LD2D.2]
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Perituberal | |
| The Specific Disease | Tuberous sclerosis complex | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.409954874; Fold-change: 0.13940655; Z-score: 0.965861795 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
ICD Disease Classification 3
Anemia [ICD-11: 3A00-3A9Z]
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Bone marrow | |
| The Specific Disease | Anemia | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.520259775; Fold-change: -0.443545079; Z-score: -0.415131846 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
Sickle cell disease [ICD-11: 3A51.0-3A51.3]
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Peripheral blood | |
| The Specific Disease | Sickle cell disease | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.000832573; Fold-change: -1.410827045; Z-score: -2.23433907 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
Thrombocythemia [ICD-11: 3B63]
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Whole blood | |
| The Specific Disease | Thrombocythemia | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.049624162; Fold-change: -0.146007475; Z-score: -0.358352025 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
ICD Disease Classification 4
Scleroderma [ICD-11: 4A42.Z]
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Whole blood | |
| The Specific Disease | Scleroderma | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 4.72E-05; Fold-change: -1.05664774; Z-score: -2.679035471 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
Sjogren syndrome [ICD-11: 4A43]
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Salivary gland | |
| The Specific Disease | Sjogren syndrome | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.661566257; Fold-change: 0.245371124; Z-score: 0.293529883 | |
| The Expression Level of Disease Section Compare with the Adjacent Tissue | p-value: 0.014075748; Fold-change: 0.644903011; Z-score: 4.756150334 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
Behcet disease [ICD-11: 4A62]
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Peripheral blood | |
| The Specific Disease | Behcet disease | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.357600776; Fold-change: -0.016701333; Z-score: -0.028055965 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
Autosomal dominant monocytopenia [ICD-11: 4B04]
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Whole blood | |
| The Specific Disease | Autosomal dominant monocytopenia | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.000317254; Fold-change: -1.403275967; Z-score: -1.49308134 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
ICD Disease Classification 5
Type 2 diabetes [ICD-11: 5A11]
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Liver | |
| The Specific Disease | Type 2 diabetes | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.848045528; Fold-change: 0.147743815; Z-score: 0.411444235 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
Polycystic ovary syndrome [ICD-11: 5A80.1]
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Vastus lateralis muscle | |
| The Specific Disease | Polycystic ovary syndrome | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.694172493; Fold-change: 0.178228924; Z-score: 0.909761957 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
Obesity [ICD-11: 5B81]
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Subcutaneous Adipose | |
| The Specific Disease | Obesity | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.240428296; Fold-change: 0.239118075; Z-score: 0.478816315 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
Pompe disease [ICD-11: 5C51.3]
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Biceps muscle | |
| The Specific Disease | Pompe disease | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.564984612; Fold-change: -0.071203428; Z-score: -0.34335573 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
Batten disease [ICD-11: 5C56.1]
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Whole blood | |
| The Specific Disease | Batten disease | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.371495533; Fold-change: -0.016020447; Z-score: -0.054823713 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
ICD Disease Classification 6
Autism [ICD-11: 6A02]
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Whole blood | |
| The Specific Disease | Autism | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.840788107; Fold-change: 0.033158583; Z-score: 0.071794103 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
Anxiety disorder [ICD-11: 6B00-6B0Z]
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Whole blood | |
| The Specific Disease | Anxiety disorder | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.226993246; Fold-change: -0.238335154; Z-score: -0.427217197 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
ICD Disease Classification 8
Parkinson disease [ICD-11: 8A00]
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Substantia nigra | |
| The Specific Disease | Parkinson disease | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.668433154; Fold-change: -0.009359675; Z-score: -0.037235992 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
Huntington disease [ICD-11: 8A01]
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Whole blood | |
| The Specific Disease | Huntington disease | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.973498321; Fold-change: 0.084527178; Z-score: 0.131647818 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
Alzheimer disease [ICD-11: 8A20]
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Entorhinal cortex | |
| The Specific Disease | Alzheimer disease | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.110730995; Fold-change: -0.046909137; Z-score: -0.252272072 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
Seizure [ICD-11: 8A60-8A6Z]
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Whole blood | |
| The Specific Disease | Seizure | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.503241594; Fold-change: 0.526856876; Z-score: 0.489157696 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
Lateral sclerosis [ICD-11: 8B60.4]
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Skin | |
| The Specific Disease | Lateral sclerosis | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.324123402; Fold-change: 0.202773208; Z-score: 0.839700073 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
| The Studied Tissue | Cervical spinal cord | |
| The Specific Disease | Lateral sclerosis | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.653849176; Fold-change: 0.066511665; Z-score: 0.415295169 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
Muscular atrophy [ICD-11: 8C70]
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Muscle | |
| The Specific Disease | Muscular atrophy | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.123535519; Fold-change: 0.142012966; Z-score: 0.599720925 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
Myopathy [ICD-11: 8C70.6]
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Muscle | |
| The Specific Disease | Myopathy | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.009090999; Fold-change: 0.354072074; Z-score: 1.97730181 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
References