Antigen Information
General Information of This Antigen (ID: TAR0YUGYX)
| Antigen Name | SLAM family member 7 (SLAMF7) |
|||||
|---|---|---|---|---|---|---|
| Gene Name | SLAMF7 |
|||||
| Gene ID | ||||||
| Synonym | CS1; UNQ576; PRO1138; CD2 subset 1;CD2-like receptor-activating cytotoxic cells;Membrane protein FOAP-12;Novel Ly9;Protein 19A;CD319 |
|||||
| Sequence |
MAGSPTCLTLIYILWQLTGSAASGPVKELVGSVGGAVTFPLKSKVKQVDSIVWTFNTTPL
VTIQPEGGTIIVTQNRNRERVDFPDGGYSLKLSKLKKNDSGIYYVGIYSSSLQQPSTQEY VLHVYEHLSKPKVTMGLQSNKNGTCVTNLTCCMEHGEEDVIYTWKALGQAANESHNGSIL PISWRWGESDMTFICVARNPVSRNFSSPILARKLCEGAADDPDSSMVLLCLLLVPLLLSL FVLGLFLWFLKRERQEEYIEEKKRVDICRETPNICPHSGENTEYDTIPHTNRTILKEDPA NTVYSTVEIPKKMENPHSLLTMPDTPRLFAYENVI Click to Show/Hide
|
|||||
| Function |
Self-ligand receptor of the signaling lymphocytic activation molecule (SLAM) family. SLAM receptors triggered by homo- or heterotypic cell-cell interactions are modulating the activation and differentiation of a wide variety of immune cells and thus are involved in the regulation and interconnection of both innate and adaptive immune response. Activities are controlled by presence or absence of small cytoplasmic adapter proteins, SH2D1A/SAP and/or SH2D1B/EAT-2. Isoform 1 mediates NK cell activation through a SH2D1A-independent extracellular signal-regulated ERK-mediated pathway. Positively regulates NK cell functions by a mechanism dependent on phosphorylated SH2D1B. Downstream signaling implicates PLCG1, PLCG2 and PI3K. In addition to heterotypic NK cells-.get cells interactions also homotypic interactions between NK cells may contribute to activation. However, in the absence of SH2D1B, inhibits NK cell function. Acts also inhibitory in T-cells. May play a role in lymphocyte adhesion. In LPS-activated monocytes negatively regulates production of pro-inflammatory cytokines.
Click to Show/Hide
|
|||||
| Uniprot Entry | ||||||
| HGNC ID | ||||||
| KEGG ID | ||||||
Each Antibody-drug Conjugate and Its Component Related to This Antigen
Full List of The ADC Related to This Antigen
| The Numbers of ADCs, Their Three Components, Payload Targets, and Corresponding Diseases for This Antigens | ||||
|---|---|---|---|---|
Azintuxizumab
| ADC Name | Payload | Target | Linker | ADC Info |
|---|---|---|---|---|
|
Azintuxizumab vedotin
|
Monomethyl auristatin E |
Microtubule (MT) |
Mc-Val-Cit-PABC |
Undisclosed
| ADC Name | Payload | Target | Linker | ADC Info |
|---|---|---|---|---|
|
SLAMF-7 targeted ETB
[1]
|
Engineered toxin body |
Undisclosed |
Undisclosed |
References
