Antigen Information

General Information of This Antigen

Antigen ID	TAR0VQYAS
Antigen Name	Interferon-stimulated gene 20 kDa protein (ISG20)
Gene Name	ISG20
Gene ID	3669
Synonym	HEM45; Estrogen-regulated transcript 45 protein;Promyelocytic leukemia nuclear body-associated protein ISG20
Sequence	MAGSREVVAMDCEMVGLGPHRESGLARCSLVNVHGAVLYDKFIRPEGEITDYRTRVSGVT PQHMVGATPFAVARLEILQLLKGKLVVGHDLKHDFQALKEDMSGYTIYDTSTDRLLWREA KLDHCRRVSLRVLSERLLHKSIQNSLLGHSSVEDARATMELYQISQRIRARRGLPRLAVS D Click to Show/Hide
Family	EPCAM family
Function	Interferon-induced antiviral exoribonuclease that acts on single-stranded RNA and also has minor activity towards single-stranded DNA. Exhibits antiviral activity against RNA viruses including hepatitis C virus (HCV), hepatitis A virus (HAV) and yellow fever virus (YFV) in an exonuclease-dependent manner. May also play additional roles in the maturation of snRNAs and rRNAs, and in ribosome biogenesis. Click to Show/Hide
Uniprot Entry	ISG20_HUMAN
HGNC ID	HGNC:6130
KEGG ID	hsa:3669

Each Antibody-drug Conjuate AND It's Component Related to This Antigen

Full List of The ADC Related to This Antigen

Anti-CD25 mAb D265A

Antibody Info

ADC Info	ADC Name	Payload	Target	Linker	Ref
ADC Info	Anti-CD25 ADC 12-1	Anti-CD25 ADC 12-1 payload	Undisclosed	Anti-CD25 ADC 12-1 linker	[1]
ADC Info	Anti-CD25 ADC 2-7	Anti-CD25 ADC 2-7 payload	Undisclosed	Anti-CD25 ADC 2-7 linker	[1]
ADC Info	Anti-CD25 ADC 3-4	Anti-CD25 ADC 3-4 payload	Undisclosed	Anti-CD25 ADC 3-4 linker	[1]
ADC Info	Anti-CD25 ADC 4-3	Anti-CD25 ADC 4-3 payload	Undisclosed	Anti-CD25 ADC 4-3 linker	[1]
ADC Info	Anti-CD25 ADC 5-3	Anti-CD25 ADC 5-3 payload	Undisclosed	Anti-CD25 ADC 5-3 linker	[1]
ADC Info	Anti-CD25 ADC 6-2	Anti-CD25 ADC 6-2 payload	Undisclosed	Anti-CD25 ADC 6-2 linker	[1]
ADC Info	Anti-CD25 ADC 7-1	Anti-CD25 ADC 7-1 payload	Undisclosed	Anti-CD25 ADC 7-1 linker	[1]
ADC Info	Anti-CD25 ADC 8-5	Anti-CD25 ADC 8-5 payload	Undisclosed	Anti-CD25 ADC 8-5 linker	[1]
ADC Info	Anti-CD25 ADC 9-4	Anti-CD25 ADC 9-4 payload	Undisclosed	Anti-CD25 ADC 9-4 linker	[1]
ADC Info	Anti-CD25 ADC 10-1	Anti-CD25 ADC 10-1 payload	Undisclosed	Anti-CD25 ADC 10-1 linker	[1]
ADC Info	Anti-CD25 ADC 11-5	Anti-CD25 ADC 11-5 payload	Undisclosed	Anti-CD25 ADC 11-5 linker	[1]
ADC Info	Anti-CD25 ADC 12-3	Anti-CD25 ADC 12-3 payload	Undisclosed	Anti-CD25 ADC 12-3 linker	[1]
ADC Info	Anti-CD25 ADC 13-7	Anti-CD25 ADC 13-7 payload	Undisclosed	Anti-CD25 ADC 13-7 linker	[1]
ADC Info	Anti-CD25 ADC 14-5	Anti-CD25 ADC 14-5 payload	Undisclosed	Anti-CD25 ADC 14-5 linker	[1]
ADC Info	Anti-CD25 ADC 15-5	Anti-CD25 ADC 15-5 payload	Undisclosed	Anti-CD25 ADC 15-5 linker	[1]
ADC Info	Anti-CD25 ADC 16-5	Anti-CD25 ADC 16-5 payload	Undisclosed	Anti-CD25 ADC 16-5 linker	[1]
ADC Info	Anti-CD25 ADC 17-2	Anti-CD25 ADC 17-2 payload	Undisclosed	Anti-CD25 ADC 17-2 linker	[1]
ADC Info	Anti-CD25 ADC 18-3	Anti-CD25 ADC 18-3 payload	Undisclosed	Anti-CD25 ADC 18-3 linker	[1]
ADC Info	Anti-CD25 ADC 19-5	Anti-CD25 ADC 19-5 payload	Undisclosed	Anti-CD25 ADC 19-5 linker	[1]
ADC Info	Anti-CD25 ADC 20-5	Anti-CD25 ADC 20-5 payload	Undisclosed	Anti-CD25 ADC 20-5 linker	[1]
ADC Info	Anti-CD25 ADC 21-5	Anti-CD25 ADC 21-5 payload	Undisclosed	Anti-CD25 ADC 21-5 linker	[1]

Anti-CD25 mAb PC61

Antibody Info

ADC Info	ADC Name	Payload	Target	Linker	Ref
ADC Info	CD25-ADC	SG3199	Human Deoxyribonucleic acid (hDNA)	Mal-PEG8-Val-Ala-PABC	[2]

Anti-CD25 mAb RFT5

Antibody Info

ADC Info	ADC Name	Payload	Target	Linker	Ref
ADC Info	RFT5-SMPT-dgA	Deglycosylated ricin A-chain (dgA)	Undisclosed	Succynimidyloxycarbonyl-alpha-methyl-alpha- (2-pyridyl-dithio) toluene (SMPT)

Basiliximab

Antibody Info

ADC Info	ADC Name	Payload	Target	Linker	Ref
ADC Info	Basiliximab sarotalocan	Undisclosed	Undisclosed	Undisclosed	[3]

Undisclosed

Antibody Info

ADC Info	ADC Name	Payload	Target	Linker	Ref
ADC Info	Anti-CD25-IR700 conjugate (Rakuten Medical)	IRDye 700DX	Undisclosed	Undisclosed	[4]

References

Ref 1	Phosphate based linkers for intracellular delivery of drug conjugates; 2015-10-08.
Ref 2	CD25-targeted antibody-drug conjugate depletes regulatory T cells and eliminates established syngeneic tumors via antitumor immunity. J Immunother Cancer. 2020 Sep;8(2):e000860. doi: 10.1136/jitc-2020-000860.
Ref 3	Introduction to basic information on ADC drug Basiliximab sarotalocan.
Ref 4	Rakuten Medical Announces FDA Acceptance of an Investigational New Drug (IND) Application for RM-1995, a Conjugate of IR700 and anti-CD25 Antibody; 15 Dec 2021.

Antigen Information

Citation

Visitor Map

Correspondence

Prof. Feng ZHU (zhufeng@zju.edu.cn)

Prof. Xiaowu DONG (dongxw@zju.edu.cn)

Prof. Luo FANG (fangluo@zjcc.org.cn)