General Information of This Antigen
Antigen ID
TAR0ROZDZ
Antigen Name
Collectin-10 (COLEC10)
Gene Name
COLEC10
Gene ID
10584
Synonym
CLL1; UNQ366; PRO702; Collectin liver protein 1;Collectin-34
Sequence
MNGFASLLRRNQFILLVLFLLQIQSLGLDIDSRPTAEVCATHTISPGPKGDDGEKGDPGE
EGKHGKVGRMGPKGIKGELGDMGDQGNIGKTGPIGKKGDKGEKGLLGIPGEKGKAGTVCD
CGRYRKFVGQLDISIARLKTSMKFVKNVIAGIRETEEKFYYIVQEEKNYRESLTHCRIRG
GMLAMPKDEAANTLIADYVAKSGFFRVFIGVNDLEREGQYMFTDNTPLQNYSNWNEGEPS
DPYGHEDCVEMLSSGRWNDTECHLTMYFVCEFIKKKK

    Click to Show/Hide
Family
Claudin family
Function
Lectin that binds to various sugars: galactose > mannose = fucose > N-acetylglucosamine > N-acetylgalactosamine. Acts as a chemoattractant, probably involved in the regulation of cell migration.

    Click to Show/Hide
Uniprot Entry
COL10_HUMAN
HGNC ID
HGNC:2220
KEGG ID
hsa:10584
Each Antibody-drug Conjuate AND It's Component Related to This Antigen
Full List of The ADC Related to This Antigen
Human hCLL-1 Anti-ody genetically fused with CD38
ADC Info ADC Name Payload Target Linker Ref
DAR2-ARC-ADC
Monomethyl auristatin F
Microtubule (MT)
NAD-based dinucleotide linker
[1]
Undisclosed
ADC Info ADC Name Payload Target Linker Ref
DAR4-ARC-ADC
Monomethyl auristatin F
Microtubule (MT)
NAD-based dinucleotide linker
[1]
Tissue/Disease specific Abundances of This Antigen
Tissue specific Abundances of This Antigen
ICD Disease Classification 01
Click to Show/Hide the 1 Disease of This Class
Bacterial infection [ICD-11: 1A00-1C4Z]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Gingival
The Specific Disease Bacterial infection of gingival
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.503761442; Fold-change: 0.004163192; Z-score: 0.017964278
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 02
Click to Show/Hide the 22 Disease of This Class
Brain cancer [ICD-11: 2A00]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Brainstem
The Specific Disease Glioma
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.996936692; Fold-change: 0.006654743; Z-score: 0.018091798
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
The Studied Tissue White matter
The Specific Disease Glioma
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.019780912; Fold-change: -0.422961093; Z-score: -1.405519088
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
The Studied Tissue Brainstem
The Specific Disease Neuroectodermal tumor
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 6.53E-05; Fold-change: -0.807143439; Z-score: -2.372442324
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
The Studied Tissue Nervous
The Specific Disease Brain cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 1.74E-06; Fold-change: -0.088897855; Z-score: -0.306057747
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Chronic myeloid leukemia [ICD-11: 2A20]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Whole blood
The Specific Disease Polycythemia vera
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.036459256; Fold-change: 0.073759023; Z-score: 0.435376067
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
The Studied Tissue Whole blood
The Specific Disease Myelofibrosis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.114435635; Fold-change: 0.085201245; Z-score: 0.51394582
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
MyeloDysplastic syndromes [ICD-11: 2A37]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Bone marrow
The Specific Disease Myelodysplastic syndromes
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.72357883; Fold-change: 0.003081548; Z-score: 0.013947093
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.113557396; Fold-change: 0.063720885; Z-score: 0.958629791
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Lymphoma [ICD-11: 2A90- 2A85]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Tonsil
The Specific Disease Lymphoma
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.97657738; Fold-change: -0.04038146; Z-score: -0.193030357
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Gastric cancer [ICD-11: 2B72]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Gastric
The Specific Disease Gastric cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.288840699; Fold-change: 0.160115694; Z-score: 0.67033628
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.00069335; Fold-change: 0.128505637; Z-score: 0.669081148
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Colon cancer [ICD-11: 2B90]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Colon
The Specific Disease Colon cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.198689381; Fold-change: -0.037703724; Z-score: -0.162725346
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.863260353; Fold-change: -0.009586002; Z-score: -0.03790574
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Pancreatic cancer [ICD-11: 2C10]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Pancreas
The Specific Disease Pancreatic cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.022595353; Fold-change: -0.215719984; Z-score: -0.735710217
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.149483313; Fold-change: -0.127567616; Z-score: -0.475079751
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Liver cancer [ICD-11: 2C12]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Liver
The Specific Disease Liver cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 1.96E-28; Fold-change: -2.056777078; Z-score: -3.69205973
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 3.29E-90; Fold-change: -2.422097304; Z-score: -2.621889444
The Expression Level of Disease Section Compare with the Other Disease Section p-value: 0.016526445; Fold-change: -2.475619107; Z-score: -2.559741094
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Lung cancer [ICD-11: 2C25]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Lung
The Specific Disease Lung cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 9.09E-20; Fold-change: -0.399030406; Z-score: -0.765504503
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 2.04E-05; Fold-change: -0.121106426; Z-score: -0.274863223
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Melanoma [ICD-11: 2C30]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Skin
The Specific Disease Melanoma
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.975824569; Fold-change: -0.047687565; Z-score: -0.067455523
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Sarcoma [ICD-11: 2C35]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Muscle
The Specific Disease Sarcoma
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 3.46E-39; Fold-change: -0.225230048; Z-score: -1.009469005
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.043914468; Fold-change: -0.258606355; Z-score: -1.764667702
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Breast cancer [ICD-11: 2C60]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Breast
The Specific Disease Breast cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 6.99E-08; Fold-change: -0.071262285; Z-score: -0.211953971
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.252674766; Fold-change: 0.019375947; Z-score: 0.079088791
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Ovarian cancer [ICD-11: 2C73]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Ovarian
The Specific Disease Ovarian cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.106756716; Fold-change: -0.299372299; Z-score: -1.053568248
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.028366675; Fold-change: -0.227921124; Z-score: -0.990096981
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Cervical cancer [ICD-11: 2C77]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Cervical
The Specific Disease Cervical cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.261852067; Fold-change: -0.066318015; Z-score: -0.259018872
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Uterine cancer [ICD-11: 2C78]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Endometrium
The Specific Disease Uterine cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.16036732; Fold-change: -0.03151385; Z-score: -0.108125159
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.031026228; Fold-change: -1.552269572; Z-score: -1.600099942
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Prostate cancer [ICD-11: 2C82]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Prostate
The Specific Disease Prostate cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.008084402; Fold-change: -0.757795809; Z-score: -0.955417794
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Bladder cancer [ICD-11: 2C94]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Bladder
The Specific Disease Bladder cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.000124999; Fold-change: 0.545667194; Z-score: 2.74969602
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Retina cancer [ICD-11: 2D02]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Uvea
The Specific Disease Retinoblastoma tumor
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.056221987; Fold-change: -0.168666078; Z-score: -0.870188074
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Thyroid cancer [ICD-11: 2D10]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Thyroid
The Specific Disease Thyroid cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 1.53E-19; Fold-change: -0.463846; Z-score: -1.214047393
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 7.07E-08; Fold-change: -0.266363137; Z-score: -0.959586149
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Adrenal cancer [ICD-11: 2D11]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Adrenal cortex
The Specific Disease Adrenocortical carcinoma
The Expression Level of Disease Section Compare with the Other Disease Section p-value: 0.453168728; Fold-change: 0.032190978; Z-score: 0.171455071
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Head and neck cancer [ICD-11: 2D42]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Head and neck
The Specific Disease Head and neck cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.060280453; Fold-change: -0.056052677; Z-score: -0.255884386
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Pituitary cancer [ICD-11: 2F37]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Pituitary
The Specific Disease Pituitary gonadotrope tumor
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.434558588; Fold-change: 0.063445754; Z-score: 0.326541257
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
The Studied Tissue Pituitary
The Specific Disease Pituitary cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.619423793; Fold-change: 0.069329191; Z-score: 0.23392831
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 03
Click to Show/Hide the 1 Disease of This Class
Thrombocytopenia [ICD-11: 3B64]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Whole blood
The Specific Disease Thrombocytopenia
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.396595917; Fold-change: 0.125469296; Z-score: 1.400460902
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 04
Click to Show/Hide the 2 Disease of This Class
Lupus erythematosus [ICD-11: 4A40]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Whole blood
The Specific Disease Lupus erythematosus
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.83582557; Fold-change: -0.063418025; Z-score: -0.113505078
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Autoimmune disease [ICD-11: 4A4Z]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Peripheral monocyte
The Specific Disease Autoimmune uveitis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.107642284; Fold-change: -0.108603537; Z-score: -0.537106991
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 05
Click to Show/Hide the 1 Disease of This Class
Hyperlipoproteinaemia [ICD-11: 5C80]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Whole blood
The Specific Disease Familial hypercholesterolemia
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.055078333; Fold-change: -0.112878361; Z-score: -0.478305297
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 06
Click to Show/Hide the 1 Disease of This Class
Schizophrenia [ICD-11: 6A20]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Superior temporal cortex
The Specific Disease Schizophrenia
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.77915962; Fold-change: -0.017629058; Z-score: -0.112221705
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 08
Click to Show/Hide the 3 Disease of This Class
Multiple sclerosis [ICD-11: 8A40]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Spinal cord
The Specific Disease Multiple sclerosis
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.229615654; Fold-change: -0.177105471; Z-score: -0.767864836
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
The Studied Tissue Plasmacytoid dendritic cells
The Specific Disease Multiple sclerosis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.062808612; Fold-change: -0.280342803; Z-score: -1.030040804
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Epilepsy [ICD-11: 8A60]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Peritumoral cortex
The Specific Disease Epilepsy
The Expression Level of Disease Section Compare with the Other Disease Section p-value: 0.188036392; Fold-change: 0.066192584; Z-score: 0.406655038
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Cerebral ischaemic stroke [ICD-11: 8B11]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Whole blood
The Specific Disease Cardioembolic Stroke
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.241875257; Fold-change: 0.130516994; Z-score: 0.496200695
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
The Studied Tissue Peripheral blood
The Specific Disease Ischemic stroke
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.715186026; Fold-change: -0.076523187; Z-score: -0.546262857
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 1
Click to Show/Hide the 6 Disease of This Class
HIV [ICD-11: 1C60-1C62]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue White matter
The Specific Disease HIV
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.19228464; Fold-change: -0.000826789; Z-score: -0.002676179
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Influenza [ICD-11: 1E30]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Whole blood
The Specific Disease Influenza
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.012830972; Fold-change: 0.358907043; Z-score: 1.793535427
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Chronic hepatitis C [ICD-11: 1E51.1]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Whole blood
The Specific Disease Chronic hepatitis C
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.143161073; Fold-change: 0.068190183; Z-score: 0.40007991
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Sepsis [ICD-11: 1G40-1G41]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Whole blood
The Specific Disease Sepsis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.000420639; Fold-change: 0.117121706; Z-score: 0.495518255
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Septic shock [ICD-11: 1G41]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Whole blood
The Specific Disease Septic shock
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 5.05E-10; Fold-change: 0.201017811; Z-score: 0.817456442
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Pediatric respiratory syncytial virus infection [ICD-11: CA40.11]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Peripheral blood
The Specific Disease Pediatric respiratory syncytial virus infection
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.956074335; Fold-change: 0.011166917; Z-score: 0.056507613
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 11
Click to Show/Hide the 6 Disease of This Class
Essential hypertension [ICD-11: BA00]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Peripheral blood
The Specific Disease Essential hypertension
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.527734304; Fold-change: 0.015618984; Z-score: 0.21912811
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Myocardial infarction [ICD-11: BA41]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Peripheral blood
The Specific Disease Myocardial infarction
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.623628216; Fold-change: 0.097572168; Z-score: 0.147287338
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Coronary artery disease [ICD-11: BA8Z]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Peripheral blood
The Specific Disease Coronary artery disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.330902229; Fold-change: 0.049980447; Z-score: 0.311732829
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Aortic stenosis [ICD-11: BB70]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Calcified aortic valve
The Specific Disease Aortic stenosis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.838988747; Fold-change: 0.053126795; Z-score: 0.13855303
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Arteriosclerosis [ICD-11: BD40]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Peripheral blood
The Specific Disease Arteriosclerosis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.200988785; Fold-change: -0.190095815; Z-score: -1.304632877
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Aneurysm [ICD-11: BD50]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Intracranial artery
The Specific Disease Aneurysm
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.961167228; Fold-change: -0.046297503; Z-score: -0.22529153
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 12
Click to Show/Hide the 8 Disease of This Class
Immunodeficiency [ICD-11: 4A00-4A20]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Peripheral blood
The Specific Disease Immunodeficiency
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.838811871; Fold-change: -0.016309055; Z-score: -0.119154429
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Apnea [ICD-11: 7A40]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Hyperplastic tonsil
The Specific Disease Apnea
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.484037502; Fold-change: 0.031796407; Z-score: 0.186609606
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Olive pollen allergy [ICD-11: CA08.00]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Peripheral blood
The Specific Disease Olive pollen allergy
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.864301182; Fold-change: 0.0092529; Z-score: 0.141324244
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Chronic rhinosinusitis [ICD-11: CA0A]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Sinus mucosa
The Specific Disease Chronic rhinosinusitis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.189052041; Fold-change: 0.057109017; Z-score: 0.756619024
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Chronic obstructive pulmonary disease [ICD-11: CA22]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Lung
The Specific Disease Chronic obstructive pulmonary disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.019917778; Fold-change: 0.230119724; Z-score: 0.723439536
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
The Studied Tissue Small airway epithelium
The Specific Disease Chronic obstructive pulmonary disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.838622676; Fold-change: -0.027005149; Z-score: -0.163129551
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Asthma [ICD-11: CA23]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Nasal and bronchial airway
The Specific Disease Asthma
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.763597713; Fold-change: 0.047905859; Z-score: 0.138484532
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Human rhinovirus infection [ICD-11: CA42]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Nasal Epithelium
The Specific Disease Human rhinovirus infection
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.9922772; Fold-change: -0.002158013; Z-score: -0.011882218
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Idiopathic pulmonary fibrosis [ICD-11: CB03.4]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Lung
The Specific Disease Idiopathic pulmonary fibrosis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.608715618; Fold-change: 0.027687404; Z-score: 0.155625832
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 13
Click to Show/Hide the 5 Disease of This Class
Periodontal disease [ICD-11: DA0C]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Gingival
The Specific Disease Periodontal disease
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.078019203; Fold-change: 0.052623712; Z-score: 0.235905364
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Eosinophilic gastritis [ICD-11: DA42.2]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Gastric antrum
The Specific Disease Eosinophilic gastritis
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.158281899; Fold-change: 0.192895966; Z-score: 1.249145374
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Liver failure [ICD-11: DB99.7-DB99.8]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Liver
The Specific Disease Liver failure
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.000956839; Fold-change: 1.093786715; Z-score: 1.810183772
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Ulcerative colitis [ICD-11: DD71]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Colon mucosal
The Specific Disease Ulcerative colitis
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.06655846; Fold-change: -0.17220486; Z-score: -0.459724622
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Irritable bowel syndrome [ICD-11: DD91.0]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Rectal colon
The Specific Disease Irritable bowel syndrome
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.268990692; Fold-change: 0.166711946; Z-score: 0.319969599
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 14
Click to Show/Hide the 5 Disease of This Class
Atopic dermatitis [ICD-11: EA80]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Skin
The Specific Disease Atopic dermatitis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.065179896; Fold-change: 0.061311951; Z-score: 0.563458281
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Psoriasis [ICD-11: EA90]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Skin
The Specific Disease Psoriasis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 8.04E-08; Fold-change: -0.190696794; Z-score: -0.534963467
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 2.40E-29; Fold-change: 0.63154951; Z-score: 2.579578093
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Vitiligo [ICD-11: ED63.0]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Skin
The Specific Disease Vitiligo
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.876611073; Fold-change: -0.001236514; Z-score: -0.006983506
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Alopecia [ICD-11: ED70]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Skin from scalp
The Specific Disease Alopecia
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.049995452; Fold-change: 0.055208906; Z-score: 0.383091884
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Sensitive skin [ICD-11: EK0Z]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Skin
The Specific Disease Sensitive skin
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.084574145; Fold-change: -0.092391163; Z-score: -0.558251627
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 15
Click to Show/Hide the 6 Disease of This Class
Osteoarthritis [ICD-11: FA00-FA0Z]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Synovial
The Specific Disease Osteoarthritis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.958991206; Fold-change: -0.094502707; Z-score: -0.276989113
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Arthropathy [ICD-11: FA00-FA5Z]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Peripheral blood
The Specific Disease Arthropathy
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.846713941; Fold-change: 0.003963433; Z-score: 0.022159238
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Arthritis [ICD-11: FA20]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Peripheral blood
The Specific Disease Arthritis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.256181947; Fold-change: 0.094237937; Z-score: 0.231805056
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Rheumatoid arthritis [ICD-11: FA20]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Synovial
The Specific Disease Rheumatoid arthritis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.699877392; Fold-change: -0.122898458; Z-score: -0.311077496
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Ankylosing spondylitis [ICD-11: FA92.0Z]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Pheripheral blood
The Specific Disease Ankylosing spondylitis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.68580016; Fold-change: 0.040716007; Z-score: 0.200793325
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Osteoporosis [ICD-11: FB83]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Bone marrow
The Specific Disease Osteoporosis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.12856434; Fold-change: 0.324128697; Z-score: 2.25363841
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 16
Click to Show/Hide the 2 Disease of This Class
Endometriosis [ICD-11: GA10]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Endometrium
The Specific Disease Endometriosis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.720862475; Fold-change: 0.018371216; Z-score: 0.023659253
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Interstitial cystitis [ICD-11: GC00.3]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Bladder
The Specific Disease Interstitial cystitis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.868338294; Fold-change: 0.006606917; Z-score: 0.056321489
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 19
Click to Show/Hide the 1 Disease of This Class
Preterm birth [ICD-11: KA21.4Z]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Myometrium
The Specific Disease Preterm birth
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.339020031; Fold-change: 0.003662732; Z-score: 0.043999301
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 2
Click to Show/Hide the 8 Disease of This Class
Acute myelocytic leukemia [ICD-11: 2A60]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Bone marrow
The Specific Disease Acute myelocytic leukemia
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.217034275; Fold-change: -0.03697124; Z-score: -0.190253673
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Myeloma [ICD-11: 2A83]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Bone marrow
The Specific Disease Myeloma
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.000407609; Fold-change: -0.495874087; Z-score: -2.276619899
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
The Studied Tissue Peripheral blood
The Specific Disease Myeloma
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.136991625; Fold-change: 0.162094927; Z-score: 0.774303384
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Oral cancer [ICD-11: 2B6E]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Oral
The Specific Disease Oral cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.095792187; Fold-change: -0.149816112; Z-score: -0.473651276
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.743336706; Fold-change: -0.046357222; Z-score: -0.172906973
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Esophagal cancer [ICD-11: 2B70]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Esophagus
The Specific Disease Esophagal cancer
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.147957066; Fold-change: 0.016154864; Z-score: 0.141876425
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Rectal cancer [ICD-11: 2B92]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Rectal colon
The Specific Disease Rectal cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.460283948; Fold-change: 0.013374293; Z-score: 0.116202003
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.601423883; Fold-change: 0.085830684; Z-score: 0.298599077
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Skin cancer [ICD-11: 2C30-2C3Z]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Skin
The Specific Disease Skin cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.444989422; Fold-change: 0.016040542; Z-score: 0.037093737
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 2.84E-34; Fold-change: 0.682458265; Z-score: 1.520665874
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Renal cancer [ICD-11: 2C90-2C91]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Kidney
The Specific Disease Renal cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.078134585; Fold-change: -0.213598539; Z-score: -0.724016646
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 3.46E-08; Fold-change: -0.32450768; Z-score: -1.114262128
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Ureter cancer [ICD-11: 2C92]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Urothelium
The Specific Disease Ureter cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.606299028; Fold-change: -0.093224222; Z-score: -0.354434482
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 20
Click to Show/Hide the 2 Disease of This Class
Simpson golabi behmel syndrome [ICD-11: LD2C]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Adipose
The Specific Disease Simpson golabi behmel syndrome
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.957189592; Fold-change: -0.011892039; Z-score: -1.634231504
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Tuberous sclerosis complex [ICD-11: LD2D.2]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Perituberal
The Specific Disease Tuberous sclerosis complex
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.201585219; Fold-change: 0.088660674; Z-score: 1.162333384
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 3
Click to Show/Hide the 3 Disease of This Class
Anemia [ICD-11: 3A00-3A9Z]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Bone marrow
The Specific Disease Anemia
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.394551465; Fold-change: 0.070589545; Z-score: 0.403564658
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Sickle cell disease [ICD-11: 3A51.0-3A51.3]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Peripheral blood
The Specific Disease Sickle cell disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.055710903; Fold-change: 0.287246914; Z-score: 1.228338918
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Thrombocythemia [ICD-11: 3B63]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Whole blood
The Specific Disease Thrombocythemia
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.170051905; Fold-change: 0.045886986; Z-score: 0.268730376
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 4
Click to Show/Hide the 4 Disease of This Class
Scleroderma [ICD-11: 4A42.Z]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Whole blood
The Specific Disease Scleroderma
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.577605473; Fold-change: -0.041766139; Z-score: -0.308843679
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Sjogren syndrome [ICD-11: 4A43]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Salivary gland
The Specific Disease Sjogren syndrome
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.02524035; Fold-change: 0.276470816; Z-score: 2.817614411
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.094173632; Fold-change: -0.366463747; Z-score: -1.282346892
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Behcet disease [ICD-11: 4A62]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Peripheral blood
The Specific Disease Behcet disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.241900419; Fold-change: -0.020066569; Z-score: -0.079998339
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Autosomal dominant monocytopenia [ICD-11: 4B04]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Whole blood
The Specific Disease Autosomal dominant monocytopenia
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 5
Click to Show/Hide the 5 Disease of This Class
Type 2 diabetes [ICD-11: 5A11]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Liver
The Specific Disease Type 2 diabetes
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.094508316; Fold-change: 0.724692302; Z-score: 1.38567524
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Polycystic ovary syndrome [ICD-11: 5A80.1]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Vastus lateralis muscle
The Specific Disease Polycystic ovary syndrome
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.800984273; Fold-change: 0.010564811; Z-score: 0.057003071
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Obesity [ICD-11: 5B81]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Subcutaneous Adipose
The Specific Disease Obesity
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.884757922; Fold-change: 0.029301128; Z-score: 0.150564517
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Pompe disease [ICD-11: 5C51.3]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Biceps muscle
The Specific Disease Pompe disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.666877355; Fold-change: 0.036547714; Z-score: 0.202614902
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Batten disease [ICD-11: 5C56.1]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Whole blood
The Specific Disease Batten disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.138307891; Fold-change: 0.155805661; Z-score: 1.305399035
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 6
Click to Show/Hide the 2 Disease of This Class
Autism [ICD-11: 6A02]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Whole blood
The Specific Disease Autism
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.486343746; Fold-change: 0.043587958; Z-score: 0.210312028
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Anxiety disorder [ICD-11: 6B00-6B0Z]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Whole blood
The Specific Disease Anxiety disorder
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.344056141; Fold-change: 0.03002473; Z-score: 0.101397754
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 8
Click to Show/Hide the 7 Disease of This Class
Parkinson disease [ICD-11: 8A00]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Substantia nigra
The Specific Disease Parkinson disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.319105227; Fold-change: -0.015171601; Z-score: -0.092836218
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Huntington disease [ICD-11: 8A01]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Whole blood
The Specific Disease Huntington disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.293848314; Fold-change: 0.065075927; Z-score: 0.627449949
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Alzheimer disease [ICD-11: 8A20]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Entorhinal cortex
The Specific Disease Alzheimer disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.156431395; Fold-change: -0.006542937; Z-score: -0.040361461
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Seizure [ICD-11: 8A60-8A6Z]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Whole blood
The Specific Disease Seizure
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.997024736; Fold-change: -0.056921165; Z-score: -0.266262858
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Lateral sclerosis [ICD-11: 8B60.4]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Skin
The Specific Disease Lateral sclerosis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.180575266; Fold-change: 0.21021847; Z-score: 0.82496083
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
The Studied Tissue Cervical spinal cord
The Specific Disease Lateral sclerosis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.649376101; Fold-change: -0.058450202; Z-score: -0.276062218
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Muscular atrophy [ICD-11: 8C70]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Muscle
The Specific Disease Muscular atrophy
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.385970133; Fold-change: -0.048798857; Z-score: -0.252669479
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Myopathy [ICD-11: 8C70.6]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Muscle
The Specific Disease Myopathy
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.243882384; Fold-change: -0.066601888; Z-score: -0.201478893
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
References
Ref 1 Site-specific antibody-drug conjugates with variable drug-to-antibody-ratios for AML therapy. J Control Release. 2021 Aug 10;336:433-442. doi: 10.1016/j.jconrel.2021.06.041. Epub 2021 Jun 29.