Antigen Information
General Information of This Antigen
Antigen ID | TAR0ROZDZ |
|||||
---|---|---|---|---|---|---|
Antigen Name | Collectin-10 (COLEC10) |
|||||
Gene Name | COLEC10 |
|||||
Gene ID | ||||||
Synonym | CLL1; UNQ366; PRO702; Collectin liver protein 1;Collectin-34 |
|||||
Sequence |
MNGFASLLRRNQFILLVLFLLQIQSLGLDIDSRPTAEVCATHTISPGPKGDDGEKGDPGE
EGKHGKVGRMGPKGIKGELGDMGDQGNIGKTGPIGKKGDKGEKGLLGIPGEKGKAGTVCD CGRYRKFVGQLDISIARLKTSMKFVKNVIAGIRETEEKFYYIVQEEKNYRESLTHCRIRG GMLAMPKDEAANTLIADYVAKSGFFRVFIGVNDLEREGQYMFTDNTPLQNYSNWNEGEPS DPYGHEDCVEMLSSGRWNDTECHLTMYFVCEFIKKKK Click to Show/Hide
|
|||||
Family | Claudin family |
|||||
Function |
Lectin that binds to various sugars: galactose > mannose = fucose > N-acetylglucosamine > N-acetylgalactosamine. Acts as a chemoattractant, probably involved in the regulation of cell migration.
Click to Show/Hide
|
|||||
Uniprot Entry | ||||||
HGNC ID | ||||||
KEGG ID |
Each Antibody-drug Conjuate AND It's Component Related to This Antigen
Full List of The ADC Related to This Antigen
Human hCLL-1 Anti-ody genetically fused with CD38
ADC Info | ADC Name | Payload | Target | Linker | Ref |
---|---|---|---|---|---|
DAR2-ARC-ADC |
Monomethyl auristatin F |
Microtubule (MT) |
NAD-based dinucleotide linker |
[1] |
Undisclosed
ADC Info | ADC Name | Payload | Target | Linker | Ref |
---|---|---|---|---|---|
DAR4-ARC-ADC |
Monomethyl auristatin F |
Microtubule (MT) |
NAD-based dinucleotide linker |
[1] |
Tissue/Disease specific Abundances of This Antigen
Tissue specific Abundances of This Antigen
ICD Disease Classification 01
Bacterial infection [ICD-11: 1A00-1C4Z]
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Gingival | |
The Specific Disease | Bacterial infection of gingival | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.503761442; Fold-change: 0.004163192; Z-score: 0.017964278 | |
Disease-specific Antigen Abundances | Click to View the Clearer Original Diagram | |
ICD Disease Classification 02
Brain cancer [ICD-11: 2A00]
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Brainstem | |
The Specific Disease | Glioma | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.996936692; Fold-change: 0.006654743; Z-score: 0.018091798 | |
Disease-specific Antigen Abundances | Click to View the Clearer Original Diagram | |
The Studied Tissue | White matter | |
The Specific Disease | Glioma | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.019780912; Fold-change: -0.422961093; Z-score: -1.405519088 | |
Disease-specific Antigen Abundances | Click to View the Clearer Original Diagram | |
The Studied Tissue | Brainstem | |
The Specific Disease | Neuroectodermal tumor | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 6.53E-05; Fold-change: -0.807143439; Z-score: -2.372442324 | |
Disease-specific Antigen Abundances | Click to View the Clearer Original Diagram | |
The Studied Tissue | Nervous | |
The Specific Disease | Brain cancer | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 1.74E-06; Fold-change: -0.088897855; Z-score: -0.306057747 | |
Disease-specific Antigen Abundances | Click to View the Clearer Original Diagram | |
Chronic myeloid leukemia [ICD-11: 2A20]
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Whole blood | |
The Specific Disease | Polycythemia vera | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.036459256; Fold-change: 0.073759023; Z-score: 0.435376067 | |
Disease-specific Antigen Abundances | Click to View the Clearer Original Diagram | |
The Studied Tissue | Whole blood | |
The Specific Disease | Myelofibrosis | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.114435635; Fold-change: 0.085201245; Z-score: 0.51394582 | |
Disease-specific Antigen Abundances | Click to View the Clearer Original Diagram | |
MyeloDysplastic syndromes [ICD-11: 2A37]
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Bone marrow | |
The Specific Disease | Myelodysplastic syndromes | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.72357883; Fold-change: 0.003081548; Z-score: 0.013947093 | |
The Expression Level of Disease Section Compare with the Adjacent Tissue | p-value: 0.113557396; Fold-change: 0.063720885; Z-score: 0.958629791 | |
Disease-specific Antigen Abundances | Click to View the Clearer Original Diagram | |
Lymphoma [ICD-11: 2A90- 2A85]
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Tonsil | |
The Specific Disease | Lymphoma | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.97657738; Fold-change: -0.04038146; Z-score: -0.193030357 | |
Disease-specific Antigen Abundances | Click to View the Clearer Original Diagram | |
Gastric cancer [ICD-11: 2B72]
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Gastric | |
The Specific Disease | Gastric cancer | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.288840699; Fold-change: 0.160115694; Z-score: 0.67033628 | |
The Expression Level of Disease Section Compare with the Adjacent Tissue | p-value: 0.00069335; Fold-change: 0.128505637; Z-score: 0.669081148 | |
Disease-specific Antigen Abundances | Click to View the Clearer Original Diagram | |
Colon cancer [ICD-11: 2B90]
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Colon | |
The Specific Disease | Colon cancer | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.198689381; Fold-change: -0.037703724; Z-score: -0.162725346 | |
The Expression Level of Disease Section Compare with the Adjacent Tissue | p-value: 0.863260353; Fold-change: -0.009586002; Z-score: -0.03790574 | |
Disease-specific Antigen Abundances | Click to View the Clearer Original Diagram | |
Pancreatic cancer [ICD-11: 2C10]
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Pancreas | |
The Specific Disease | Pancreatic cancer | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.022595353; Fold-change: -0.215719984; Z-score: -0.735710217 | |
The Expression Level of Disease Section Compare with the Adjacent Tissue | p-value: 0.149483313; Fold-change: -0.127567616; Z-score: -0.475079751 | |
Disease-specific Antigen Abundances | Click to View the Clearer Original Diagram | |
Liver cancer [ICD-11: 2C12]
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Liver | |
The Specific Disease | Liver cancer | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 1.96E-28; Fold-change: -2.056777078; Z-score: -3.69205973 | |
The Expression Level of Disease Section Compare with the Adjacent Tissue | p-value: 3.29E-90; Fold-change: -2.422097304; Z-score: -2.621889444 | |
The Expression Level of Disease Section Compare with the Other Disease Section | p-value: 0.016526445; Fold-change: -2.475619107; Z-score: -2.559741094 | |
Disease-specific Antigen Abundances | Click to View the Clearer Original Diagram | |
Lung cancer [ICD-11: 2C25]
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Lung | |
The Specific Disease | Lung cancer | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 9.09E-20; Fold-change: -0.399030406; Z-score: -0.765504503 | |
The Expression Level of Disease Section Compare with the Adjacent Tissue | p-value: 2.04E-05; Fold-change: -0.121106426; Z-score: -0.274863223 | |
Disease-specific Antigen Abundances | Click to View the Clearer Original Diagram | |
Melanoma [ICD-11: 2C30]
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Skin | |
The Specific Disease | Melanoma | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.975824569; Fold-change: -0.047687565; Z-score: -0.067455523 | |
Disease-specific Antigen Abundances | Click to View the Clearer Original Diagram | |
Sarcoma [ICD-11: 2C35]
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Muscle | |
The Specific Disease | Sarcoma | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 3.46E-39; Fold-change: -0.225230048; Z-score: -1.009469005 | |
The Expression Level of Disease Section Compare with the Adjacent Tissue | p-value: 0.043914468; Fold-change: -0.258606355; Z-score: -1.764667702 | |
Disease-specific Antigen Abundances | Click to View the Clearer Original Diagram | |
Breast cancer [ICD-11: 2C60]
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Breast | |
The Specific Disease | Breast cancer | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 6.99E-08; Fold-change: -0.071262285; Z-score: -0.211953971 | |
The Expression Level of Disease Section Compare with the Adjacent Tissue | p-value: 0.252674766; Fold-change: 0.019375947; Z-score: 0.079088791 | |
Disease-specific Antigen Abundances | Click to View the Clearer Original Diagram | |
Ovarian cancer [ICD-11: 2C73]
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Ovarian | |
The Specific Disease | Ovarian cancer | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.106756716; Fold-change: -0.299372299; Z-score: -1.053568248 | |
The Expression Level of Disease Section Compare with the Adjacent Tissue | p-value: 0.028366675; Fold-change: -0.227921124; Z-score: -0.990096981 | |
Disease-specific Antigen Abundances | Click to View the Clearer Original Diagram | |
Cervical cancer [ICD-11: 2C77]
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Cervical | |
The Specific Disease | Cervical cancer | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.261852067; Fold-change: -0.066318015; Z-score: -0.259018872 | |
Disease-specific Antigen Abundances | Click to View the Clearer Original Diagram | |
Uterine cancer [ICD-11: 2C78]
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Endometrium | |
The Specific Disease | Uterine cancer | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.16036732; Fold-change: -0.03151385; Z-score: -0.108125159 | |
The Expression Level of Disease Section Compare with the Adjacent Tissue | p-value: 0.031026228; Fold-change: -1.552269572; Z-score: -1.600099942 | |
Disease-specific Antigen Abundances | Click to View the Clearer Original Diagram | |
Prostate cancer [ICD-11: 2C82]
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Prostate | |
The Specific Disease | Prostate cancer | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.008084402; Fold-change: -0.757795809; Z-score: -0.955417794 | |
Disease-specific Antigen Abundances | Click to View the Clearer Original Diagram | |
Bladder cancer [ICD-11: 2C94]
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Bladder | |
The Specific Disease | Bladder cancer | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.000124999; Fold-change: 0.545667194; Z-score: 2.74969602 | |
Disease-specific Antigen Abundances | Click to View the Clearer Original Diagram | |
Retina cancer [ICD-11: 2D02]
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Uvea | |
The Specific Disease | Retinoblastoma tumor | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.056221987; Fold-change: -0.168666078; Z-score: -0.870188074 | |
Disease-specific Antigen Abundances | Click to View the Clearer Original Diagram | |
Thyroid cancer [ICD-11: 2D10]
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Thyroid | |
The Specific Disease | Thyroid cancer | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 1.53E-19; Fold-change: -0.463846; Z-score: -1.214047393 | |
The Expression Level of Disease Section Compare with the Adjacent Tissue | p-value: 7.07E-08; Fold-change: -0.266363137; Z-score: -0.959586149 | |
Disease-specific Antigen Abundances | Click to View the Clearer Original Diagram | |
Adrenal cancer [ICD-11: 2D11]
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Adrenal cortex | |
The Specific Disease | Adrenocortical carcinoma | |
The Expression Level of Disease Section Compare with the Other Disease Section | p-value: 0.453168728; Fold-change: 0.032190978; Z-score: 0.171455071 | |
Disease-specific Antigen Abundances | Click to View the Clearer Original Diagram | |
Head and neck cancer [ICD-11: 2D42]
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Head and neck | |
The Specific Disease | Head and neck cancer | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.060280453; Fold-change: -0.056052677; Z-score: -0.255884386 | |
Disease-specific Antigen Abundances | Click to View the Clearer Original Diagram | |
Pituitary cancer [ICD-11: 2F37]
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Pituitary | |
The Specific Disease | Pituitary gonadotrope tumor | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.434558588; Fold-change: 0.063445754; Z-score: 0.326541257 | |
Disease-specific Antigen Abundances | Click to View the Clearer Original Diagram | |
The Studied Tissue | Pituitary | |
The Specific Disease | Pituitary cancer | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.619423793; Fold-change: 0.069329191; Z-score: 0.23392831 | |
Disease-specific Antigen Abundances | Click to View the Clearer Original Diagram | |
ICD Disease Classification 03
Thrombocytopenia [ICD-11: 3B64]
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Whole blood | |
The Specific Disease | Thrombocytopenia | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.396595917; Fold-change: 0.125469296; Z-score: 1.400460902 | |
Disease-specific Antigen Abundances | Click to View the Clearer Original Diagram | |
ICD Disease Classification 04
Lupus erythematosus [ICD-11: 4A40]
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Whole blood | |
The Specific Disease | Lupus erythematosus | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.83582557; Fold-change: -0.063418025; Z-score: -0.113505078 | |
Disease-specific Antigen Abundances | Click to View the Clearer Original Diagram | |
Autoimmune disease [ICD-11: 4A4Z]
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Peripheral monocyte | |
The Specific Disease | Autoimmune uveitis | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.107642284; Fold-change: -0.108603537; Z-score: -0.537106991 | |
Disease-specific Antigen Abundances | Click to View the Clearer Original Diagram | |
ICD Disease Classification 05
Hyperlipoproteinaemia [ICD-11: 5C80]
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Whole blood | |
The Specific Disease | Familial hypercholesterolemia | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.055078333; Fold-change: -0.112878361; Z-score: -0.478305297 | |
Disease-specific Antigen Abundances | Click to View the Clearer Original Diagram | |
ICD Disease Classification 06
Schizophrenia [ICD-11: 6A20]
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Superior temporal cortex | |
The Specific Disease | Schizophrenia | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.77915962; Fold-change: -0.017629058; Z-score: -0.112221705 | |
Disease-specific Antigen Abundances | Click to View the Clearer Original Diagram | |
ICD Disease Classification 08
Multiple sclerosis [ICD-11: 8A40]
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Spinal cord | |
The Specific Disease | Multiple sclerosis | |
The Expression Level of Disease Section Compare with the Adjacent Tissue | p-value: 0.229615654; Fold-change: -0.177105471; Z-score: -0.767864836 | |
Disease-specific Antigen Abundances | Click to View the Clearer Original Diagram | |
The Studied Tissue | Plasmacytoid dendritic cells | |
The Specific Disease | Multiple sclerosis | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.062808612; Fold-change: -0.280342803; Z-score: -1.030040804 | |
Disease-specific Antigen Abundances | Click to View the Clearer Original Diagram | |
Epilepsy [ICD-11: 8A60]
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Peritumoral cortex | |
The Specific Disease | Epilepsy | |
The Expression Level of Disease Section Compare with the Other Disease Section | p-value: 0.188036392; Fold-change: 0.066192584; Z-score: 0.406655038 | |
Disease-specific Antigen Abundances | Click to View the Clearer Original Diagram | |
Cerebral ischaemic stroke [ICD-11: 8B11]
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Whole blood | |
The Specific Disease | Cardioembolic Stroke | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.241875257; Fold-change: 0.130516994; Z-score: 0.496200695 | |
Disease-specific Antigen Abundances | Click to View the Clearer Original Diagram | |
The Studied Tissue | Peripheral blood | |
The Specific Disease | Ischemic stroke | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.715186026; Fold-change: -0.076523187; Z-score: -0.546262857 | |
Disease-specific Antigen Abundances | Click to View the Clearer Original Diagram | |
ICD Disease Classification 1
HIV [ICD-11: 1C60-1C62]
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | White matter | |
The Specific Disease | HIV | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.19228464; Fold-change: -0.000826789; Z-score: -0.002676179 | |
Disease-specific Antigen Abundances | Click to View the Clearer Original Diagram | |
Influenza [ICD-11: 1E30]
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Whole blood | |
The Specific Disease | Influenza | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.012830972; Fold-change: 0.358907043; Z-score: 1.793535427 | |
Disease-specific Antigen Abundances | Click to View the Clearer Original Diagram | |
Chronic hepatitis C [ICD-11: 1E51.1]
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Whole blood | |
The Specific Disease | Chronic hepatitis C | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.143161073; Fold-change: 0.068190183; Z-score: 0.40007991 | |
Disease-specific Antigen Abundances | Click to View the Clearer Original Diagram | |
Sepsis [ICD-11: 1G40-1G41]
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Whole blood | |
The Specific Disease | Sepsis | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.000420639; Fold-change: 0.117121706; Z-score: 0.495518255 | |
Disease-specific Antigen Abundances | Click to View the Clearer Original Diagram | |
Septic shock [ICD-11: 1G41]
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Whole blood | |
The Specific Disease | Septic shock | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 5.05E-10; Fold-change: 0.201017811; Z-score: 0.817456442 | |
Disease-specific Antigen Abundances | Click to View the Clearer Original Diagram | |
Pediatric respiratory syncytial virus infection [ICD-11: CA40.11]
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Peripheral blood | |
The Specific Disease | Pediatric respiratory syncytial virus infection | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.956074335; Fold-change: 0.011166917; Z-score: 0.056507613 | |
Disease-specific Antigen Abundances | Click to View the Clearer Original Diagram | |
ICD Disease Classification 11
Essential hypertension [ICD-11: BA00]
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Peripheral blood | |
The Specific Disease | Essential hypertension | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.527734304; Fold-change: 0.015618984; Z-score: 0.21912811 | |
Disease-specific Antigen Abundances | Click to View the Clearer Original Diagram | |
Myocardial infarction [ICD-11: BA41]
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Peripheral blood | |
The Specific Disease | Myocardial infarction | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.623628216; Fold-change: 0.097572168; Z-score: 0.147287338 | |
Disease-specific Antigen Abundances | Click to View the Clearer Original Diagram | |
Coronary artery disease [ICD-11: BA8Z]
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Peripheral blood | |
The Specific Disease | Coronary artery disease | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.330902229; Fold-change: 0.049980447; Z-score: 0.311732829 | |
Disease-specific Antigen Abundances | Click to View the Clearer Original Diagram | |
Aortic stenosis [ICD-11: BB70]
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Calcified aortic valve | |
The Specific Disease | Aortic stenosis | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.838988747; Fold-change: 0.053126795; Z-score: 0.13855303 | |
Disease-specific Antigen Abundances | Click to View the Clearer Original Diagram | |
Arteriosclerosis [ICD-11: BD40]
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Peripheral blood | |
The Specific Disease | Arteriosclerosis | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.200988785; Fold-change: -0.190095815; Z-score: -1.304632877 | |
Disease-specific Antigen Abundances | Click to View the Clearer Original Diagram | |
Aneurysm [ICD-11: BD50]
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Intracranial artery | |
The Specific Disease | Aneurysm | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.961167228; Fold-change: -0.046297503; Z-score: -0.22529153 | |
Disease-specific Antigen Abundances | Click to View the Clearer Original Diagram | |
ICD Disease Classification 12
Immunodeficiency [ICD-11: 4A00-4A20]
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Peripheral blood | |
The Specific Disease | Immunodeficiency | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.838811871; Fold-change: -0.016309055; Z-score: -0.119154429 | |
Disease-specific Antigen Abundances | Click to View the Clearer Original Diagram | |
Apnea [ICD-11: 7A40]
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Hyperplastic tonsil | |
The Specific Disease | Apnea | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.484037502; Fold-change: 0.031796407; Z-score: 0.186609606 | |
Disease-specific Antigen Abundances | Click to View the Clearer Original Diagram | |
Olive pollen allergy [ICD-11: CA08.00]
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Peripheral blood | |
The Specific Disease | Olive pollen allergy | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.864301182; Fold-change: 0.0092529; Z-score: 0.141324244 | |
Disease-specific Antigen Abundances | Click to View the Clearer Original Diagram | |
Chronic rhinosinusitis [ICD-11: CA0A]
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Sinus mucosa | |
The Specific Disease | Chronic rhinosinusitis | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.189052041; Fold-change: 0.057109017; Z-score: 0.756619024 | |
Disease-specific Antigen Abundances | Click to View the Clearer Original Diagram | |
Chronic obstructive pulmonary disease [ICD-11: CA22]
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Lung | |
The Specific Disease | Chronic obstructive pulmonary disease | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.019917778; Fold-change: 0.230119724; Z-score: 0.723439536 | |
Disease-specific Antigen Abundances | Click to View the Clearer Original Diagram | |
The Studied Tissue | Small airway epithelium | |
The Specific Disease | Chronic obstructive pulmonary disease | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.838622676; Fold-change: -0.027005149; Z-score: -0.163129551 | |
Disease-specific Antigen Abundances | Click to View the Clearer Original Diagram | |
Asthma [ICD-11: CA23]
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Nasal and bronchial airway | |
The Specific Disease | Asthma | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.763597713; Fold-change: 0.047905859; Z-score: 0.138484532 | |
Disease-specific Antigen Abundances | Click to View the Clearer Original Diagram | |
Human rhinovirus infection [ICD-11: CA42]
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Nasal Epithelium | |
The Specific Disease | Human rhinovirus infection | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.9922772; Fold-change: -0.002158013; Z-score: -0.011882218 | |
Disease-specific Antigen Abundances | Click to View the Clearer Original Diagram | |
Idiopathic pulmonary fibrosis [ICD-11: CB03.4]
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Lung | |
The Specific Disease | Idiopathic pulmonary fibrosis | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.608715618; Fold-change: 0.027687404; Z-score: 0.155625832 | |
Disease-specific Antigen Abundances | Click to View the Clearer Original Diagram | |
ICD Disease Classification 13
Periodontal disease [ICD-11: DA0C]
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Gingival | |
The Specific Disease | Periodontal disease | |
The Expression Level of Disease Section Compare with the Adjacent Tissue | p-value: 0.078019203; Fold-change: 0.052623712; Z-score: 0.235905364 | |
Disease-specific Antigen Abundances | Click to View the Clearer Original Diagram | |
Eosinophilic gastritis [ICD-11: DA42.2]
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Gastric antrum | |
The Specific Disease | Eosinophilic gastritis | |
The Expression Level of Disease Section Compare with the Adjacent Tissue | p-value: 0.158281899; Fold-change: 0.192895966; Z-score: 1.249145374 | |
Disease-specific Antigen Abundances | Click to View the Clearer Original Diagram | |
Liver failure [ICD-11: DB99.7-DB99.8]
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Liver | |
The Specific Disease | Liver failure | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.000956839; Fold-change: 1.093786715; Z-score: 1.810183772 | |
Disease-specific Antigen Abundances | Click to View the Clearer Original Diagram | |
Ulcerative colitis [ICD-11: DD71]
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Colon mucosal | |
The Specific Disease | Ulcerative colitis | |
The Expression Level of Disease Section Compare with the Adjacent Tissue | p-value: 0.06655846; Fold-change: -0.17220486; Z-score: -0.459724622 | |
Disease-specific Antigen Abundances | Click to View the Clearer Original Diagram | |
Irritable bowel syndrome [ICD-11: DD91.0]
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Rectal colon | |
The Specific Disease | Irritable bowel syndrome | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.268990692; Fold-change: 0.166711946; Z-score: 0.319969599 | |
Disease-specific Antigen Abundances | Click to View the Clearer Original Diagram | |
ICD Disease Classification 14
Atopic dermatitis [ICD-11: EA80]
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Skin | |
The Specific Disease | Atopic dermatitis | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.065179896; Fold-change: 0.061311951; Z-score: 0.563458281 | |
Disease-specific Antigen Abundances | Click to View the Clearer Original Diagram | |
Psoriasis [ICD-11: EA90]
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Skin | |
The Specific Disease | Psoriasis | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 8.04E-08; Fold-change: -0.190696794; Z-score: -0.534963467 | |
The Expression Level of Disease Section Compare with the Adjacent Tissue | p-value: 2.40E-29; Fold-change: 0.63154951; Z-score: 2.579578093 | |
Disease-specific Antigen Abundances | Click to View the Clearer Original Diagram | |
Vitiligo [ICD-11: ED63.0]
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Skin | |
The Specific Disease | Vitiligo | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.876611073; Fold-change: -0.001236514; Z-score: -0.006983506 | |
Disease-specific Antigen Abundances | Click to View the Clearer Original Diagram | |
Alopecia [ICD-11: ED70]
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Skin from scalp | |
The Specific Disease | Alopecia | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.049995452; Fold-change: 0.055208906; Z-score: 0.383091884 | |
Disease-specific Antigen Abundances | Click to View the Clearer Original Diagram | |
Sensitive skin [ICD-11: EK0Z]
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Skin | |
The Specific Disease | Sensitive skin | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.084574145; Fold-change: -0.092391163; Z-score: -0.558251627 | |
Disease-specific Antigen Abundances | Click to View the Clearer Original Diagram | |
ICD Disease Classification 15
Osteoarthritis [ICD-11: FA00-FA0Z]
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Synovial | |
The Specific Disease | Osteoarthritis | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.958991206; Fold-change: -0.094502707; Z-score: -0.276989113 | |
Disease-specific Antigen Abundances | Click to View the Clearer Original Diagram | |
Arthropathy [ICD-11: FA00-FA5Z]
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Peripheral blood | |
The Specific Disease | Arthropathy | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.846713941; Fold-change: 0.003963433; Z-score: 0.022159238 | |
Disease-specific Antigen Abundances | Click to View the Clearer Original Diagram | |
Arthritis [ICD-11: FA20]
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Peripheral blood | |
The Specific Disease | Arthritis | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.256181947; Fold-change: 0.094237937; Z-score: 0.231805056 | |
Disease-specific Antigen Abundances | Click to View the Clearer Original Diagram | |
Rheumatoid arthritis [ICD-11: FA20]
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Synovial | |
The Specific Disease | Rheumatoid arthritis | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.699877392; Fold-change: -0.122898458; Z-score: -0.311077496 | |
Disease-specific Antigen Abundances | Click to View the Clearer Original Diagram | |
Ankylosing spondylitis [ICD-11: FA92.0Z]
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Pheripheral blood | |
The Specific Disease | Ankylosing spondylitis | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.68580016; Fold-change: 0.040716007; Z-score: 0.200793325 | |
Disease-specific Antigen Abundances | Click to View the Clearer Original Diagram | |
Osteoporosis [ICD-11: FB83]
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Bone marrow | |
The Specific Disease | Osteoporosis | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.12856434; Fold-change: 0.324128697; Z-score: 2.25363841 | |
Disease-specific Antigen Abundances | Click to View the Clearer Original Diagram | |
ICD Disease Classification 16
Endometriosis [ICD-11: GA10]
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Endometrium | |
The Specific Disease | Endometriosis | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.720862475; Fold-change: 0.018371216; Z-score: 0.023659253 | |
Disease-specific Antigen Abundances | Click to View the Clearer Original Diagram | |
Interstitial cystitis [ICD-11: GC00.3]
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Bladder | |
The Specific Disease | Interstitial cystitis | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.868338294; Fold-change: 0.006606917; Z-score: 0.056321489 | |
Disease-specific Antigen Abundances | Click to View the Clearer Original Diagram | |
ICD Disease Classification 19
Preterm birth [ICD-11: KA21.4Z]
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Myometrium | |
The Specific Disease | Preterm birth | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.339020031; Fold-change: 0.003662732; Z-score: 0.043999301 | |
Disease-specific Antigen Abundances | Click to View the Clearer Original Diagram | |
ICD Disease Classification 2
Acute myelocytic leukemia [ICD-11: 2A60]
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Bone marrow | |
The Specific Disease | Acute myelocytic leukemia | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.217034275; Fold-change: -0.03697124; Z-score: -0.190253673 | |
Disease-specific Antigen Abundances | Click to View the Clearer Original Diagram | |
Myeloma [ICD-11: 2A83]
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Bone marrow | |
The Specific Disease | Myeloma | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.000407609; Fold-change: -0.495874087; Z-score: -2.276619899 | |
Disease-specific Antigen Abundances | Click to View the Clearer Original Diagram | |
The Studied Tissue | Peripheral blood | |
The Specific Disease | Myeloma | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.136991625; Fold-change: 0.162094927; Z-score: 0.774303384 | |
Disease-specific Antigen Abundances | Click to View the Clearer Original Diagram | |
Oral cancer [ICD-11: 2B6E]
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Oral | |
The Specific Disease | Oral cancer | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.095792187; Fold-change: -0.149816112; Z-score: -0.473651276 | |
The Expression Level of Disease Section Compare with the Adjacent Tissue | p-value: 0.743336706; Fold-change: -0.046357222; Z-score: -0.172906973 | |
Disease-specific Antigen Abundances | Click to View the Clearer Original Diagram | |
Esophagal cancer [ICD-11: 2B70]
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Esophagus | |
The Specific Disease | Esophagal cancer | |
The Expression Level of Disease Section Compare with the Adjacent Tissue | p-value: 0.147957066; Fold-change: 0.016154864; Z-score: 0.141876425 | |
Disease-specific Antigen Abundances | Click to View the Clearer Original Diagram | |
Rectal cancer [ICD-11: 2B92]
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Rectal colon | |
The Specific Disease | Rectal cancer | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.460283948; Fold-change: 0.013374293; Z-score: 0.116202003 | |
The Expression Level of Disease Section Compare with the Adjacent Tissue | p-value: 0.601423883; Fold-change: 0.085830684; Z-score: 0.298599077 | |
Disease-specific Antigen Abundances | Click to View the Clearer Original Diagram | |
Skin cancer [ICD-11: 2C30-2C3Z]
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Skin | |
The Specific Disease | Skin cancer | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.444989422; Fold-change: 0.016040542; Z-score: 0.037093737 | |
The Expression Level of Disease Section Compare with the Adjacent Tissue | p-value: 2.84E-34; Fold-change: 0.682458265; Z-score: 1.520665874 | |
Disease-specific Antigen Abundances | Click to View the Clearer Original Diagram | |
Renal cancer [ICD-11: 2C90-2C91]
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Kidney | |
The Specific Disease | Renal cancer | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.078134585; Fold-change: -0.213598539; Z-score: -0.724016646 | |
The Expression Level of Disease Section Compare with the Adjacent Tissue | p-value: 3.46E-08; Fold-change: -0.32450768; Z-score: -1.114262128 | |
Disease-specific Antigen Abundances | Click to View the Clearer Original Diagram | |
Ureter cancer [ICD-11: 2C92]
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Urothelium | |
The Specific Disease | Ureter cancer | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.606299028; Fold-change: -0.093224222; Z-score: -0.354434482 | |
Disease-specific Antigen Abundances | Click to View the Clearer Original Diagram | |
ICD Disease Classification 20
Simpson golabi behmel syndrome [ICD-11: LD2C]
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Adipose | |
The Specific Disease | Simpson golabi behmel syndrome | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.957189592; Fold-change: -0.011892039; Z-score: -1.634231504 | |
Disease-specific Antigen Abundances | Click to View the Clearer Original Diagram | |
Tuberous sclerosis complex [ICD-11: LD2D.2]
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Perituberal | |
The Specific Disease | Tuberous sclerosis complex | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.201585219; Fold-change: 0.088660674; Z-score: 1.162333384 | |
Disease-specific Antigen Abundances | Click to View the Clearer Original Diagram | |
ICD Disease Classification 3
Anemia [ICD-11: 3A00-3A9Z]
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Bone marrow | |
The Specific Disease | Anemia | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.394551465; Fold-change: 0.070589545; Z-score: 0.403564658 | |
Disease-specific Antigen Abundances | Click to View the Clearer Original Diagram | |
Sickle cell disease [ICD-11: 3A51.0-3A51.3]
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Peripheral blood | |
The Specific Disease | Sickle cell disease | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.055710903; Fold-change: 0.287246914; Z-score: 1.228338918 | |
Disease-specific Antigen Abundances | Click to View the Clearer Original Diagram | |
Thrombocythemia [ICD-11: 3B63]
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Whole blood | |
The Specific Disease | Thrombocythemia | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.170051905; Fold-change: 0.045886986; Z-score: 0.268730376 | |
Disease-specific Antigen Abundances | Click to View the Clearer Original Diagram | |
ICD Disease Classification 4
Scleroderma [ICD-11: 4A42.Z]
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Whole blood | |
The Specific Disease | Scleroderma | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.577605473; Fold-change: -0.041766139; Z-score: -0.308843679 | |
Disease-specific Antigen Abundances | Click to View the Clearer Original Diagram | |
Sjogren syndrome [ICD-11: 4A43]
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Salivary gland | |
The Specific Disease | Sjogren syndrome | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.02524035; Fold-change: 0.276470816; Z-score: 2.817614411 | |
The Expression Level of Disease Section Compare with the Adjacent Tissue | p-value: 0.094173632; Fold-change: -0.366463747; Z-score: -1.282346892 | |
Disease-specific Antigen Abundances | Click to View the Clearer Original Diagram | |
Behcet disease [ICD-11: 4A62]
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Peripheral blood | |
The Specific Disease | Behcet disease | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.241900419; Fold-change: -0.020066569; Z-score: -0.079998339 | |
Disease-specific Antigen Abundances | Click to View the Clearer Original Diagram | |
Autosomal dominant monocytopenia [ICD-11: 4B04]
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Whole blood | |
The Specific Disease | Autosomal dominant monocytopenia | |
Disease-specific Antigen Abundances | Click to View the Clearer Original Diagram | |
ICD Disease Classification 5
Type 2 diabetes [ICD-11: 5A11]
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Liver | |
The Specific Disease | Type 2 diabetes | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.094508316; Fold-change: 0.724692302; Z-score: 1.38567524 | |
Disease-specific Antigen Abundances | Click to View the Clearer Original Diagram | |
Polycystic ovary syndrome [ICD-11: 5A80.1]
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Vastus lateralis muscle | |
The Specific Disease | Polycystic ovary syndrome | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.800984273; Fold-change: 0.010564811; Z-score: 0.057003071 | |
Disease-specific Antigen Abundances | Click to View the Clearer Original Diagram | |
Obesity [ICD-11: 5B81]
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Subcutaneous Adipose | |
The Specific Disease | Obesity | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.884757922; Fold-change: 0.029301128; Z-score: 0.150564517 | |
Disease-specific Antigen Abundances | Click to View the Clearer Original Diagram | |
Pompe disease [ICD-11: 5C51.3]
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Biceps muscle | |
The Specific Disease | Pompe disease | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.666877355; Fold-change: 0.036547714; Z-score: 0.202614902 | |
Disease-specific Antigen Abundances | Click to View the Clearer Original Diagram | |
Batten disease [ICD-11: 5C56.1]
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Whole blood | |
The Specific Disease | Batten disease | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.138307891; Fold-change: 0.155805661; Z-score: 1.305399035 | |
Disease-specific Antigen Abundances | Click to View the Clearer Original Diagram | |
ICD Disease Classification 6
Autism [ICD-11: 6A02]
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Whole blood | |
The Specific Disease | Autism | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.486343746; Fold-change: 0.043587958; Z-score: 0.210312028 | |
Disease-specific Antigen Abundances | Click to View the Clearer Original Diagram | |
Anxiety disorder [ICD-11: 6B00-6B0Z]
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Whole blood | |
The Specific Disease | Anxiety disorder | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.344056141; Fold-change: 0.03002473; Z-score: 0.101397754 | |
Disease-specific Antigen Abundances | Click to View the Clearer Original Diagram | |
ICD Disease Classification 8
Parkinson disease [ICD-11: 8A00]
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Substantia nigra | |
The Specific Disease | Parkinson disease | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.319105227; Fold-change: -0.015171601; Z-score: -0.092836218 | |
Disease-specific Antigen Abundances | Click to View the Clearer Original Diagram | |
Huntington disease [ICD-11: 8A01]
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Whole blood | |
The Specific Disease | Huntington disease | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.293848314; Fold-change: 0.065075927; Z-score: 0.627449949 | |
Disease-specific Antigen Abundances | Click to View the Clearer Original Diagram | |
Alzheimer disease [ICD-11: 8A20]
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Entorhinal cortex | |
The Specific Disease | Alzheimer disease | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.156431395; Fold-change: -0.006542937; Z-score: -0.040361461 | |
Disease-specific Antigen Abundances | Click to View the Clearer Original Diagram | |
Seizure [ICD-11: 8A60-8A6Z]
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Whole blood | |
The Specific Disease | Seizure | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.997024736; Fold-change: -0.056921165; Z-score: -0.266262858 | |
Disease-specific Antigen Abundances | Click to View the Clearer Original Diagram | |
Lateral sclerosis [ICD-11: 8B60.4]
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Skin | |
The Specific Disease | Lateral sclerosis | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.180575266; Fold-change: 0.21021847; Z-score: 0.82496083 | |
Disease-specific Antigen Abundances | Click to View the Clearer Original Diagram | |
The Studied Tissue | Cervical spinal cord | |
The Specific Disease | Lateral sclerosis | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.649376101; Fold-change: -0.058450202; Z-score: -0.276062218 | |
Disease-specific Antigen Abundances | Click to View the Clearer Original Diagram | |
Muscular atrophy [ICD-11: 8C70]
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Muscle | |
The Specific Disease | Muscular atrophy | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.385970133; Fold-change: -0.048798857; Z-score: -0.252669479 | |
Disease-specific Antigen Abundances | Click to View the Clearer Original Diagram | |
Myopathy [ICD-11: 8C70.6]
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Muscle | |
The Specific Disease | Myopathy | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.243882384; Fold-change: -0.066601888; Z-score: -0.201478893 | |
Disease-specific Antigen Abundances | Click to View the Clearer Original Diagram | |
References
If you find any error in data or bug in web service, please kindly report it to Dr. Shen et al.