Antigen ID	TAR0OIMZX
Antigen Name	CAMPATH-1 antigen (CD52)
Gene Name	CD52
Gene ID	1043
Synonym	CDW52; HE5; CDw52; Cambridge pathology 1 antigen; Epididymal secretory protein E5; Human epididymis-specific protein 5; CD_antigen=CD52
Sequence	MKRFLFLLLTISLLVMVQIQTGLSGQNDTSQTSSPSASSNISGGIFLFFVANAIIHLFCF S     Click to Show/Hide
Function	May play a role in carrying and orienting carbohydrate, as well as having a more specific role.     Click to Show/Hide
Uniprot Entry	CD52_HUMAN
HGNC ID	HGNC:1804
KEGG ID	hsa:1043

ADC Info	ADC Name	Payload	Target	Linker	Ref
ADC Info	Alemtuzumab-Compound 9	Mertansine DM1	Microtubule (MT)	Alemtuzumab-Compound 9 linker	[1]
ADC Info	Alemtuzumab-Compound 17	Mertansine DM4	Microtubule (MT)	Alemtuzumab-Compound 17 linker	[1]
ADC Info	Alemtuzumab-Compound 25	Monomethyl auristatin E	Microtubule (MT)	Alemtuzumab-Compound 25 linker	[1]
ADC Info	Alemtuzumab-Compound 31	Auristatin 0101	Microtubule (MT)	Alemtuzumab-Compound 31 linker	[1]
ADC Info	Alemtuzumab-Compound 36	Monomethyl auristatin E	Microtubule (MT)	Alemtuzumab-Compound 36 linker	[1]
ADC Info	Alemtuzumab-Compound 43	PBD dimer	Human Deoxyribonucleic acid (hDNA)	Alemtuzumab-Compound 43 linker	[1]
ADC Info	Alemtuzumab-Compound 49	PBD dimer	Human Deoxyribonucleic acid (hDNA)	Alemtuzumab-Compound 49 linker	[1]
ADC Info	Alemtuzumab-Compound 55	Mertansine DM1	Microtubule (MT)	Alemtuzumab-Compound 55 linker	[1]
ADC Info	Alemtuzumab-Compound 59	Mertansine DM4	Microtubule (MT)	Alemtuzumab-Compound 59 linker	[1]
ADC Info	Alemtuzumab-Compound 64	Monomethyl auristatin E	Microtubule (MT)	Alemtuzumab-Compound 64 linker	[1]
ADC Info	Alemtuzumab-Compound 69	Monomethyl auristatin E	Microtubule (MT)	Alemtuzumab-Compound 69 linker	[1]
ADC Info	Alemtuzumab-Compound 74	PBD dimer	Human Deoxyribonucleic acid (hDNA)	Alemtuzumab-Compound 74 linker	[1]
ADC Info	Alemtuzumab-Compound 75	Monomethyl auristatin E	Microtubule (MT)	Alemtuzumab-Compound 75 linker	[1]
ADC Info	Alemtuzumab-Compound 76	Monomethyl auristatin E	Microtubule (MT)	Alemtuzumab-Compound 76 linker	[1]
ADC Info	Alemtuzumab-Compound 77	Mertansine DM1	Microtubule (MT)	Alemtuzumab-Compound 77 linker	[1]
ADC Info	Alemtuzumab-Compound 78	Auristatin 0101	Microtubule (MT)	Alemtuzumab-Compound 78 linker	[1]
ADC Info	Alemtuzumab-Compound 79	Auristatin 0101	Microtubule (MT)	Alemtuzumab-Compound 79 linker	[1]
ADC Info	Alemtuzumab-Compound 80	Mertansine DM4	Microtubule (MT)	Alemtuzumab-Compound 80 linker	[1]

ADC Info	ADC Name	Payload	Target	Linker	Ref
ADC Info	12G6 N297Q/S298N/Y300S-Mc-Val-Cit-PABC-MMAE	Monomethyl auristatin E	Microtubule (MT)	Mc-Val-Cit-PABC	[2]

ADC Info	ADC Name	Payload	Target	Linker	Ref
ADC Info	12G6 S298N/T299A/Y300S-Mc-Val-Cit-PABC-MMAE	Monomethyl auristatin E	Microtubule (MT)	Mc-Val-Cit-PABC	[2]

ADC Info	ADC Name	Payload	Target	Linker	Ref
ADC Info	12G6 S298N/Y300S-Mc-Val-Cit-PABC-MMAE	Monomethyl auristatin E	Microtubule (MT)	Mc-Val-Cit-PABC	[2]

ADC Info	ADC Name	Payload	Target	Linker	Ref
ADC Info	12G6 WT-Mc-Val-Cit-PABC-MMAE	Monomethyl auristatin E	Microtubule (MT)	Mc-Val-Cit-PABC	[2]

ADC Info	ADC Name	Payload	Target	Linker	Ref
ADC Info	2C3 A114N-Mc-Val-Cit-PABC-MMAE	Monomethyl auristatin E	Microtubule (MT)	Mc-Val-Cit-PABC	[2]

ADC Info	ADC Name	Payload	Target	Linker	Ref
ADC Info	2C3 NGT-Mc-Val-Cit-PABC-MMAE	Monomethyl auristatin E	Microtubule (MT)	Mc-Val-Cit-PABC	[2]

ADC Info	ADC Name	Payload	Target	Linker	Ref
ADC Info	2C3 S298N Y300S-Mc-Val-Cit-PABC-MMAE	Monomethyl auristatin E	Microtubule (MT)	Mc-Val-Cit-PABC	[2]

ADC Info	ADC Name	Payload	Target	Linker	Ref
ADC Info	2C3 S440N-Mc-Val-Cit-PABC-MMAE	Monomethyl auristatin E	Microtubule (MT)	Mc-Val-Cit-PABC	[2]

ADC Info	ADC Name	Payload	Target	Linker	Ref
ADC Info	2C3 S442N-Mc-Val-Cit-PABC-MMAE	Monomethyl auristatin E	Microtubule (MT)	Mc-Val-Cit-PABC	[2]

ADC Info	ADC Name	Payload	Target	Linker	Ref
ADC Info	2C3 WT-Mc-Val-Cit-PABC-MMAE	Monomethyl auristatin E	Microtubule (MT)	Mc-Val-Cit-PABC	[2]

ADC Info	ADC Name	Payload	Target	Linker	Ref
ADC Info	2C3 Y436S-Mc-Val-Cit-PABC-MMAE	Monomethyl auristatin E	Microtubule (MT)	Mc-Val-Cit-PABC	[2]

Ref 1	Covalent linkers in antibody-drug conjugates and methods of making and using the same.
Ref 2	Site-specific antibody-drug conjugation through glycoengineering.