Antigen Information
General Information of This Antigen (ID: TAR0OIMZX)
| Antigen Name | CAMPATH-1 antigen (CD52) |
|||||
|---|---|---|---|---|---|---|
| Gene Name | CD52 |
|||||
| Gene ID | ||||||
| Synonym | CDW52; HE5; CDw52; Cambridge pathology 1 antigen; Epididymal secretory protein E5; Human epididymis-specific protein 5; CD52 |
|||||
| Sequence |
MKRFLFLLLTISLLVMVQIQTGLSGQNDTSQTSSPSASSNISGGIFLFFVANAIIHLFCF
S Click to Show/Hide
|
|||||
| Function |
May play a role in carrying and orienting carbohydrate, as well as having a more specific role.
Click to Show/Hide
|
|||||
| Uniprot Entry | ||||||
| HGNC ID | ||||||
| KEGG ID | ||||||
Each Antibody-drug Conjugate and Its Component Related to This Antigen
Full List of The ADC Related to This Antigen
| The Numbers of ADCs, Their Three Components, Payload Targets, and Corresponding Diseases for This Antigens | ||||
|---|---|---|---|---|
Alemtuzumab
| ADC Name | Payload | Target | Linker | ADC Info |
|---|---|---|---|---|
|
Alemtuzumab-Compound 9
[1]
|
Mertansine DM1 |
Microtubule (MT) |
Alemtuzumab-Compound 9 linker |
|
|
Alemtuzumab-Compound 17
[1]
|
Mertansine DM4 |
Microtubule (MT) |
Alemtuzumab-Compound 17 linker |
|
|
Alemtuzumab-Compound 25
[1]
|
Monomethyl auristatin E |
Microtubule (MT) |
Alemtuzumab-Compound 25 linker |
|
|
Alemtuzumab-Compound 31
[1]
|
Auristatin 0101 |
Microtubule (MT) |
Alemtuzumab-Compound 31 linker |
|
|
Alemtuzumab-Compound 36
[1]
|
Monomethyl auristatin E |
Microtubule (MT) |
Alemtuzumab-Compound 36 linker |
|
|
Alemtuzumab-Compound 43
[1]
|
PBD dimer |
Human Deoxyribonucleic acid (hDNA) |
Alemtuzumab-Compound 43 linker |
|
|
Alemtuzumab-Compound 49
[1]
|
PBD dimer |
Human Deoxyribonucleic acid (hDNA) |
Alemtuzumab-Compound 49 linker |
|
|
Alemtuzumab-Compound 55
[1]
|
Mertansine DM1 |
Microtubule (MT) |
Alemtuzumab-Compound 55 linker |
|
|
Alemtuzumab-Compound 59
[1]
|
Mertansine DM4 |
Microtubule (MT) |
Alemtuzumab-Compound 59 linker |
|
|
Alemtuzumab-Compound 64
[1]
|
Monomethyl auristatin E |
Microtubule (MT) |
Alemtuzumab-Compound 64 linker |
|
|
Alemtuzumab-Compound 69
[1]
|
Monomethyl auristatin E |
Microtubule (MT) |
Alemtuzumab-Compound 69 linker |
|
|
Alemtuzumab-Compound 74
[1]
|
PBD dimer |
Human Deoxyribonucleic acid (hDNA) |
Alemtuzumab-Compound 74 linker |
|
|
Alemtuzumab-Compound 75
[1]
|
Monomethyl auristatin E |
Microtubule (MT) |
Alemtuzumab-Compound 75 linker |
|
|
Alemtuzumab-Compound 76
[1]
|
Monomethyl auristatin E |
Microtubule (MT) |
Alemtuzumab-Compound 76 linker |
|
|
Alemtuzumab-Compound 77
[1]
|
Mertansine DM1 |
Microtubule (MT) |
Alemtuzumab-Compound 77 linker |
|
|
Alemtuzumab-Compound 78
[1]
|
Auristatin 0101 |
Microtubule (MT) |
Alemtuzumab-Compound 78 linker |
|
|
Alemtuzumab-Compound 79
[1]
|
Auristatin 0101 |
Microtubule (MT) |
Alemtuzumab-Compound 79 linker |
|
|
Alemtuzumab-Compound 80
[1]
|
Mertansine DM4 |
Microtubule (MT) |
Alemtuzumab-Compound 80 linker |
|
|
JP7623413B2 ExampleADC51
[2]
|
Undisclosed |
Undisclosed |
Undisclosed |
|
|
JP7560255B2 ControlADC51
[3]
|
Undisclosed |
Undisclosed |
Undisclosed |
Anti-CD52 mAb 12G6 N297Q/S298N/Y300S
| ADC Name | Payload | Target | Linker | ADC Info |
|---|---|---|---|---|
|
12G6 N297Q/S298N/Y300S-Mc-Val-Cit-PABC-MMAE
[4]
|
Monomethyl auristatin E |
Microtubule (MT) |
Mc-Val-Cit-PABC |
Anti-CD52 mAb 12G6 S298N/T299A/Y300S
| ADC Name | Payload | Target | Linker | ADC Info |
|---|---|---|---|---|
|
12G6 S298N/T299A/Y300S-Mc-Val-Cit-PABC-MMAE
[4]
|
Monomethyl auristatin E |
Microtubule (MT) |
Mc-Val-Cit-PABC |
Anti-CD52 mAb 12G6 S298N/Y300S
| ADC Name | Payload | Target | Linker | ADC Info |
|---|---|---|---|---|
|
12G6 S298N/Y300S-Mc-Val-Cit-PABC-MMAE
[4]
|
Monomethyl auristatin E |
Microtubule (MT) |
Mc-Val-Cit-PABC |
Anti-CD52 mAb 12G6 WT
| ADC Name | Payload | Target | Linker | ADC Info |
|---|---|---|---|---|
|
12G6 WT-Mc-Val-Cit-PABC-MMAE
[4]
|
Monomethyl auristatin E |
Microtubule (MT) |
Mc-Val-Cit-PABC |
Anti-CD52 mAb 2C3 A114N
| ADC Name | Payload | Target | Linker | ADC Info |
|---|---|---|---|---|
|
2C3 A114N-Mc-Val-Cit-PABC-MMAE
[4]
|
Monomethyl auristatin E |
Microtubule (MT) |
Mc-Val-Cit-PABC |
Anti-CD52 mAb 2C3 NGT
| ADC Name | Payload | Target | Linker | ADC Info |
|---|---|---|---|---|
|
2C3 NGT-Mc-Val-Cit-PABC-MMAE
[4]
|
Monomethyl auristatin E |
Microtubule (MT) |
Mc-Val-Cit-PABC |
Anti-CD52 mAb 2C3 S298N Y300S
| ADC Name | Payload | Target | Linker | ADC Info |
|---|---|---|---|---|
|
2C3 S298N Y300S-Mc-Val-Cit-PABC-MMAE
[4]
|
Monomethyl auristatin E |
Microtubule (MT) |
Mc-Val-Cit-PABC |
Anti-CD52 mAb 2C3 S440N
| ADC Name | Payload | Target | Linker | ADC Info |
|---|---|---|---|---|
|
2C3 S440N-Mc-Val-Cit-PABC-MMAE
[4]
|
Monomethyl auristatin E |
Microtubule (MT) |
Mc-Val-Cit-PABC |
Anti-CD52 mAb 2C3 S442N
| ADC Name | Payload | Target | Linker | ADC Info |
|---|---|---|---|---|
|
2C3 S442N-Mc-Val-Cit-PABC-MMAE
[4]
|
Monomethyl auristatin E |
Microtubule (MT) |
Mc-Val-Cit-PABC |
Anti-CD52 mAb 2C3 WT
| ADC Name | Payload | Target | Linker | ADC Info |
|---|---|---|---|---|
|
2C3 WT-Mc-Val-Cit-PABC-MMAE
[4]
|
Monomethyl auristatin E |
Microtubule (MT) |
Mc-Val-Cit-PABC |
Anti-CD52 mAb 2C3 Y436S
| ADC Name | Payload | Target | Linker | ADC Info |
|---|---|---|---|---|
|
2C3 Y436S-Mc-Val-Cit-PABC-MMAE
[4]
|
Monomethyl auristatin E |
Microtubule (MT) |
Mc-Val-Cit-PABC |
References
