Antigen ID	TAR0MSWGX
Antigen Name	Tumor necrosis factor (TNF)
Gene Name	TNF
Gene ID	7124
Synonym	TNFA; TNFSF2; Cachectin;TNF-alpha;Tumor necrosis factor ligand superfamily member 2
Sequence	MSTESMIRDVELAEEALPKKTGGPQGSRRCLFLSLFSFLIVAGATTLFCLLHFGVIGPQR EEFPRDLSLISPLAQAVRSSSRTPSDKPVAHVVANPQAEGQLQWLNRRANALLANGVELR DNQLVVPSEGLYLIYSQVLFKGQGCPSTHVLLTHTISRIAVSYQTKVNLLSAIKSPCQRE TPEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINRPDYLDFAESGQVYFGIIAL     Click to Show/Hide
Family	Tumor necrosis factor family
Function	Cytokine that binds to TNFRSF1A/TNFR1 and TNFRSF1B/TNFBR. It is mainly secreted by macrophages and can induce cell death of certain tumor cell lines. It is potent pyrogen causing fever by direct action or by stimulation of interleukin-1 secretion and is implicated in the induction of cachexia, Under certain conditions it can stimulate cell proliferation and induce cell differentiation. Impairs regulatory T- cells (Treg) function in individuals with rheumatoid arthritis via FOXP3 dephosphorylation. Up-regulates the expression of protein phosphatase 1 (PP1), which dephosphorylates the key 'Ser-418' residue of FOXP3, thereby inactivating FOXP3 and rendering Treg cells functionally defective. Key mediator of cell death in the anticancer action of BCG-stimulated neutrophils in combination with DIABLO/SMAC mimetic in the RT4v6 bladder cancer cell line. Induces insulin resistance in adipocytes via inhibition of insulin-induced IRS1 tyrosine phosphorylation and insulin-induced glucose uptake. Induces GKAP42 protein degradation in adipocytes which is partially responsible for TNF-induced insulin resistance. Plays a role in angiogenesis by inducing VEGF production synergistically with IL1B and IL6.     Click to Show/Hide
Uniprot Entry	TNFA_HUMAN
HGNC ID	HGNC:11892
KEGG ID	hsa:7124

ADC Info	ADC Name	Payload	Target	Linker	Ref
ADC Info	ABBV-154	Glucocorticoid receptor modulator	Glucocorticoid receptor (NR3C1)	Formyl-Gly-Glu	[1]
ADC Info	Adalimumab fosimdesonide	SGD-1882	Human Deoxyribonucleic acid (hDNA)	Undisclosed	[2]
ADC Info	WO2022135332A1 1-9	WO2022135332A1_1-9 payload	Undisclosed	WO2022135332A1_1-9 linker	[3]
ADC Info	WO2022135332A1 1-10	WO2022135332A1_1-10 payload	Undisclosed	WO2022135332A1_1-10 linker	[3]
ADC Info	WO2022135332A1 1-11	WO2022135332A1_1-11 payload	Undisclosed	WO2022135332A1_1-11 linker	[3]
ADC Info	WO2022135332A1 1-13	WO2022135332A1_1-13 payload	Undisclosed	WO2022135332A1_1-13 linker	[3]
ADC Info	Adalimumab/anti-Ang2 Zybody	Angiopep-2 TFA	Undisclosed	Undisclosed	[4]
ADC Info	WO2022171101A1 ADC-45	WO2022171101A1 ADC-45 payload	Undisclosed	WO2022171101A1 ADC-45 linker	[5]
ADC Info	WO2022171101A1 ADC-48	WO2022171101A1 ADC-48 payload	Undisclosed	WO2022171101A1 ADC-48 linker	[5]
ADC Info	WO2023025248A1 ADC-56	WO2023025248A1 ADC-56 payload	Undisclosed	WO2023025248A1 ADC-56 linker	[6]
ADC Info	Adalimumab-Compound 9	Mertansine DM1	Microtubule (MT)	Adalimumab-Compound 9 linker	[7]
ADC Info	Adalimumab-Compound 17	Mertansine DM4	Microtubule (MT)	Adalimumab-Compound 17 linker	[7]
ADC Info	Adalimumab-Compound 25	Monomethyl auristatin E	Microtubule (MT)	Adalimumab-Compound 25 linker	[7]
ADC Info	Adalimumab-Compound 31	Auristatin 0101	Microtubule (MT)	Adalimumab-Compound 31 linker	[7]
ADC Info	Adalimumab-Compound 36	Monomethyl auristatin E	Microtubule (MT)	Adalimumab-Compound 36 linker	[7]
ADC Info	Adalimumab-Compound 43	PBD dimer	Human Deoxyribonucleic acid (hDNA)	Adalimumab-Compound 43 linker	[7]
ADC Info	Adalimumab-Compound 49	PBD dimer	Human Deoxyribonucleic acid (hDNA)	Adalimumab-Compound 49 linker	[7]
ADC Info	Adalimumab-Compound 55	Mertansine DM1	Microtubule (MT)	Adalimumab-Compound 55 linker	[7]
ADC Info	Adalimumab-Compound 59	Mertansine DM4	Microtubule (MT)	Adalimumab-Compound 59 linker	[7]
ADC Info	Adalimumab-Compound 64	Monomethyl auristatin E	Microtubule (MT)	Adalimumab-Compound 64 linker	[7]
ADC Info	Adalimumab-Compound 69	Monomethyl auristatin E	Microtubule (MT)	Adalimumab-Compound 69 linker	[7]
ADC Info	Adalimumab-Compound 74	PBD dimer	Human Deoxyribonucleic acid (hDNA)	Adalimumab-Compound 74 linker	[7]
ADC Info	Adalimumab-Compound 75	Monomethyl auristatin E	Microtubule (MT)	Adalimumab-Compound 75 linker	[7]
ADC Info	Adalimumab-Compound 76	Monomethyl auristatin E	Microtubule (MT)	Adalimumab-Compound 76 linker	[7]
ADC Info	Adalimumab-Compound 77	Mertansine DM1	Microtubule (MT)	Adalimumab-Compound 77 linker	[7]
ADC Info	Adalimumab-Compound 78	Auristatin 0101	Microtubule (MT)	Adalimumab-Compound 78 linker	[7]
ADC Info	Adalimumab-Compound 79	Auristatin 0101	Microtubule (MT)	Adalimumab-Compound 79 linker	[7]
ADC Info	Adalimumab-Compound 80	Mertansine DM4	Microtubule (MT)	Adalimumab-Compound 80 linker	[7]

ADC Info	ADC Name	Payload	Target	Linker	Ref
ADC Info	Golimumab-Compound 9	Mertansine DM1	Microtubule (MT)	Golimumab-Compound 9 linker	[7]
ADC Info	Golimumab-Compound 17	Mertansine DM4	Microtubule (MT)	Golimumab-Compound 17 linker	[7]
ADC Info	Golimumab-Compound 25	Monomethyl auristatin E	Microtubule (MT)	Golimumab-Compound 25 linker	[7]
ADC Info	Golimumab-Compound 31	Auristatin 0101	Microtubule (MT)	Golimumab-Compound 31 linker	[7]
ADC Info	Golimumab-Compound 36	Monomethyl auristatin E	Microtubule (MT)	Golimumab-Compound 36 linker	[7]
ADC Info	Golimumab-Compound 43	PBD dimer	Human Deoxyribonucleic acid (hDNA)	Golimumab-Compound 43 linker	[7]
ADC Info	Golimumab-Compound 49	PBD dimer	Human Deoxyribonucleic acid (hDNA)	Golimumab-Compound 49 linker	[7]
ADC Info	Golimumab-Compound 55	Mertansine DM1	Microtubule (MT)	Golimumab-Compound 55 linker	[7]
ADC Info	Golimumab-Compound 59	Mertansine DM4	Microtubule (MT)	Golimumab-Compound 59 linker	[7]
ADC Info	Golimumab-Compound 64	Monomethyl auristatin E	Microtubule (MT)	Golimumab-Compound 64 linker	[7]
ADC Info	Golimumab-Compound 69	Monomethyl auristatin E	Microtubule (MT)	Golimumab-Compound 69 linker	[7]
ADC Info	Golimumab-Compound 74	PBD dimer	Human Deoxyribonucleic acid (hDNA)	Golimumab-Compound 74 linker	[7]
ADC Info	Golimumab-Compound 75	Monomethyl auristatin E	Microtubule (MT)	Golimumab-Compound 75 linker	[7]
ADC Info	Golimumab-Compound 76	Monomethyl auristatin E	Microtubule (MT)	Golimumab-Compound 76 linker	[7]
ADC Info	Golimumab-Compound 77	Mertansine DM1	Microtubule (MT)	Golimumab-Compound 77 linker	[7]
ADC Info	Golimumab-Compound 78	Auristatin 0101	Microtubule (MT)	Golimumab-Compound 78 linker	[7]
ADC Info	Golimumab-Compound 79	Auristatin 0101	Microtubule (MT)	Golimumab-Compound 79 linker	[7]
ADC Info	Golimumab-Compound 80	Mertansine DM4	Microtubule (MT)	Golimumab-Compound 80 linker	[7]

ADC Info	ADC Name	Payload	Target	Linker	Ref
ADC Info	Infliximab-Compound 9	Mertansine DM1	Microtubule (MT)	Infliximab-Compound 9 linker	[7]
ADC Info	Infliximab-Compound 17	Mertansine DM4	Microtubule (MT)	Infliximab-Compound 17 linker	[7]
ADC Info	Infliximab-Compound 25	Monomethyl auristatin E	Microtubule (MT)	Infliximab-Compound 25 linker	[7]
ADC Info	Infliximab-Compound 31	Auristatin 0101	Microtubule (MT)	Infliximab-Compound 31 linker	[7]
ADC Info	Infliximab-Compound 36	Monomethyl auristatin E	Microtubule (MT)	Infliximab-Compound 36 linker	[7]
ADC Info	Infliximab-Compound 43	PBD dimer	Human Deoxyribonucleic acid (hDNA)	Infliximab-Compound 43 linker	[7]
ADC Info	Infliximab-Compound 49	PBD dimer	Human Deoxyribonucleic acid (hDNA)	Infliximab-Compound 49 linker	[7]
ADC Info	Infliximab-Compound 55	Mertansine DM1	Microtubule (MT)	Infliximab-Compound 55 linker	[7]
ADC Info	Infliximab-Compound 59	Mertansine DM4	Microtubule (MT)	Infliximab-Compound 59 linker	[7]
ADC Info	Infliximab-Compound 64	Monomethyl auristatin E	Microtubule (MT)	Infliximab-Compound 64 linker	[7]
ADC Info	Infliximab-Compound 69	Monomethyl auristatin E	Microtubule (MT)	Infliximab-Compound 69 linker	[7]
ADC Info	Infliximab-Compound 74	PBD dimer	Human Deoxyribonucleic acid (hDNA)	Infliximab-Compound 74 linker	[7]
ADC Info	Infliximab-Compound 75	Monomethyl auristatin E	Microtubule (MT)	Infliximab-Compound 75 linker	[7]
ADC Info	Infliximab-Compound 76	Monomethyl auristatin E	Microtubule (MT)	Infliximab-Compound 76 linker	[7]
ADC Info	Infliximab-Compound 77	Mertansine DM1	Microtubule (MT)	Infliximab-Compound 77 linker	[7]
ADC Info	Infliximab-Compound 78	Auristatin 0101	Microtubule (MT)	Infliximab-Compound 78 linker	[7]
ADC Info	Infliximab-Compound 79	Auristatin 0101	Microtubule (MT)	Infliximab-Compound 79 linker	[7]
ADC Info	Infliximab-Compound 80	Mertansine DM4	Microtubule (MT)	Infliximab-Compound 80 linker	[7]

Differential expression pattern of antigen in diseases
The Studied Tissue	Gingival
The Specific Disease	Bacterial infection of gingival
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.094384156; Fold-change: 0.088870992; Z-score: 0.319430381
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Brainstem
The Specific Disease	Glioma
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.490428815; Fold-change: -0.404829408; Z-score: -1.238791153
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual
The Studied Tissue	White matter
The Specific Disease	Glioma
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.401804072; Fold-change: -0.814121217; Z-score: -0.578536956
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual
The Studied Tissue	Brainstem
The Specific Disease	Neuroectodermal tumor
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 9.43E-06; Fold-change: -1.4020002; Z-score: -2.629246036
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual
The Studied Tissue	Nervous
The Specific Disease	Brain cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 1.89E-25; Fold-change: 0.257600928; Z-score: 0.638275929
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Whole blood
The Specific Disease	Polycythemia vera
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.001740536; Fold-change: 0.091678941; Z-score: 0.452834174
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual
The Studied Tissue	Whole blood
The Specific Disease	Myelofibrosis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.00917976; Fold-change: 0.135449234; Z-score: 0.750610945
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Bone marrow
The Specific Disease	Myelodysplastic syndromes
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.382189312; Fold-change: 0.034827371; Z-score: 0.032876956
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 0.092004586; Fold-change: -2.156222525; Z-score: -1.023544878
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Tonsil
The Specific Disease	Lymphoma
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.709296906; Fold-change: 0.147819378; Z-score: 0.283410846
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Gastric
The Specific Disease	Gastric cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.264070609; Fold-change: 0.083955484; Z-score: 0.359492096
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 2.47E-08; Fold-change: 0.188297239; Z-score: 1.303986192
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Colon
The Specific Disease	Colon cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 1.90E-13; Fold-change: -0.266408977; Z-score: -0.835758008
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 0.488670982; Fold-change: -0.069850791; Z-score: -0.176844793
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Pancreas
The Specific Disease	Pancreatic cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.059201359; Fold-change: -0.256655273; Z-score: -0.497992976
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 0.005633743; Fold-change: -0.234663117; Z-score: -0.574459695
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Liver
The Specific Disease	Liver cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 5.05E-10; Fold-change: -0.318529022; Z-score: -1.294904843
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 8.51E-12; Fold-change: -0.192774085; Z-score: -0.643185415
The Expression Level of Disease Section Compare with the Other Disease Section	p-value: 0.294713471; Fold-change: -0.228366134; Z-score: -0.773687945
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual Download Antigen expression data in the tissue of the other disease section

Differential expression pattern of antigen in diseases
The Studied Tissue	Lung
The Specific Disease	Lung cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 2.20E-19; Fold-change: -0.430957377; Z-score: -0.902045624
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 8.14E-16; Fold-change: -0.491849878; Z-score: -1.013241801
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Skin
The Specific Disease	Melanoma
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.940209347; Fold-change: -0.267524401; Z-score: -0.399095079
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Muscle
The Specific Disease	Sarcoma
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 8.79E-06; Fold-change: 0.032153522; Z-score: 0.124270956
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 0.108355798; Fold-change: -0.278324343; Z-score: -1.244625946
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Breast
The Specific Disease	Breast cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 4.75E-14; Fold-change: 0.124942795; Z-score: 0.350483629
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 0.001810869; Fold-change: 0.041745497; Z-score: 0.114625927
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Ovarian
The Specific Disease	Ovarian cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.051520581; Fold-change: 0.165943117; Z-score: 0.336145924
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 0.269528; Fold-change: 0.175491972; Z-score: 0.313545606
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Cervical
The Specific Disease	Cervical cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.013907793; Fold-change: -0.09470984; Z-score: -0.478697297
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Endometrium
The Specific Disease	Uterine cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.471161137; Fold-change: 0.008176641; Z-score: 0.012902469
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 0.550755391; Fold-change: -0.490287275; Z-score: -0.911780987
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Prostate
The Specific Disease	Prostate cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.087867138; Fold-change: 0.067126467; Z-score: 0.110279122
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Bladder
The Specific Disease	Bladder cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 4.62E-05; Fold-change: 0.347761324; Z-score: 2.140829881
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Uvea
The Specific Disease	Retinoblastoma tumor
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.042102937; Fold-change: 0.103691154; Z-score: 0.750739653
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Thyroid
The Specific Disease	Thyroid cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 2.94E-05; Fold-change: 0.215249743; Z-score: 0.471483504
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 0.005256362; Fold-change: 0.167457607; Z-score: 0.382735015
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Adrenal cortex
The Specific Disease	Adrenocortical carcinoma
The Expression Level of Disease Section Compare with the Other Disease Section	p-value: 0.023094167; Fold-change: -0.131662047; Z-score: -0.969241606
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of the other disease section

Differential expression pattern of antigen in diseases
The Studied Tissue	Head and neck
The Specific Disease	Head and neck cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 3.25E-06; Fold-change: 0.331190751; Z-score: 0.660675596
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Pituitary
The Specific Disease	Pituitary gonadotrope tumor
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.020041642; Fold-change: 0.12596528; Z-score: 0.859069802
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual
The Studied Tissue	Pituitary
The Specific Disease	Pituitary cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.058183971; Fold-change: 0.236415435; Z-score: 0.662095845
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Whole blood
The Specific Disease	Thrombocytopenia
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.741920164; Fold-change: -0.358397879; Z-score: -0.494455255
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Whole blood
The Specific Disease	Lupus erythematosus
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.638713217; Fold-change: 0.124805593; Z-score: 0.131593117
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Peripheral monocyte
The Specific Disease	Autoimmune uveitis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.092722953; Fold-change: -0.353708643; Z-score: -0.327045982
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Whole blood
The Specific Disease	Familial hypercholesterolemia
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.102878704; Fold-change: 0.336409243; Z-score: 1.087539184
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Superior temporal cortex
The Specific Disease	Schizophrenia
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.561626399; Fold-change: 0.023977523; Z-score: 0.261247689
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Spinal cord
The Specific Disease	Multiple sclerosis
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 0.686748986; Fold-change: -0.005163135; Z-score: -0.025797011
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section Download Antigen expression data of patients in the disease section of the tissue
The Studied Tissue	Plasmacytoid dendritic cells
The Specific Disease	Multiple sclerosis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.017078793; Fold-change: 0.26858842; Z-score: 0.813168773
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Peritumoral cortex
The Specific Disease	Epilepsy
The Expression Level of Disease Section Compare with the Other Disease Section	p-value: 0.828816916; Fold-change: -0.027381195; Z-score: -0.113643395
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of the other disease section

Differential expression pattern of antigen in diseases
The Studied Tissue	Whole blood
The Specific Disease	Cardioembolic Stroke
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.692195663; Fold-change: -0.047330282; Z-score: -0.216158299
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual
The Studied Tissue	Peripheral blood
The Specific Disease	Ischemic stroke
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.013732072; Fold-change: 2.612903057; Z-score: 1.424708249
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	White matter
The Specific Disease	HIV
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.161792773; Fold-change: -0.055508125; Z-score: -0.161287245
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Whole blood
The Specific Disease	Influenza
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.000380924; Fold-change: 1.616933607; Z-score: 6.029099829
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Whole blood
The Specific Disease	Chronic hepatitis C
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.235579687; Fold-change: 0.199038676; Z-score: 0.233965457
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Whole blood
The Specific Disease	Sepsis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 1.82E-05; Fold-change: 0.160827897; Z-score: 0.420579343
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Whole blood
The Specific Disease	Septic shock
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 2.39E-24; Fold-change: 0.247019643; Z-score: 0.734298063
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Peripheral blood
The Specific Disease	Pediatric respiratory syncytial virus infection
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.171679588; Fold-change: 0.358740811; Z-score: 0.792282241
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Peripheral blood
The Specific Disease	Essential hypertension
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.41950696; Fold-change: -0.145125647; Z-score: -2.12080896
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Peripheral blood
The Specific Disease	Myocardial infarction
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.001209338; Fold-change: 0.339569374; Z-score: 0.357465603
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Peripheral blood
The Specific Disease	Coronary artery disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.613545096; Fold-change: 0.231749004; Z-score: 0.565774605
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Calcified aortic valve
The Specific Disease	Aortic stenosis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.134568524; Fold-change: 0.004641557; Z-score: 0.017402723
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Peripheral blood
The Specific Disease	Arteriosclerosis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.40172396; Fold-change: -0.019784309; Z-score: -0.115206238
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Intracranial artery
The Specific Disease	Aneurysm
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 2.54E-05; Fold-change: 1.432718244; Z-score: 3.456917998
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Peripheral blood
The Specific Disease	Immunodeficiency
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.536719201; Fold-change: 0.00570044; Z-score: 0.045076811
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Hyperplastic tonsil
The Specific Disease	Apnea
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.012039743; Fold-change: 0.283851955; Z-score: 1.527974047
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Peripheral blood
The Specific Disease	Olive pollen allergy
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.030025556; Fold-change: -1.047631431; Z-score: -1.761683299
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Sinus mucosa
The Specific Disease	Chronic rhinosinusitis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.578817296; Fold-change: 0.04407224; Z-score: 0.329365343
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Lung
The Specific Disease	Chronic obstructive pulmonary disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.172422353; Fold-change: 0.127670774; Z-score: 0.40415083
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual
The Studied Tissue	Small airway epithelium
The Specific Disease	Chronic obstructive pulmonary disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.171665611; Fold-change: 0.057338701; Z-score: 0.175417806
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Nasal and bronchial airway
The Specific Disease	Asthma
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.012118064; Fold-change: 0.075042517; Z-score: 0.142465385
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Nasal Epithelium
The Specific Disease	Human rhinovirus infection
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.039153259; Fold-change: 0.064759703; Z-score: 0.356460518
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Lung
The Specific Disease	Idiopathic pulmonary fibrosis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.86439808; Fold-change: -0.055106752; Z-score: -0.159162326
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Gingival
The Specific Disease	Periodontal disease
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 0.016900342; Fold-change: 0.099462109; Z-score: 0.356775566
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section Download Antigen expression data of patients in the disease section of the tissue

Differential expression pattern of antigen in diseases
The Studied Tissue	Gastric antrum
The Specific Disease	Eosinophilic gastritis
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 0.771417255; Fold-change: -0.018268879; Z-score: -0.12347993
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section Download Antigen expression data of patients in the disease section of the tissue

Differential expression pattern of antigen in diseases
The Studied Tissue	Liver
The Specific Disease	Liver failure
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.322752541; Fold-change: -0.061302954; Z-score: -0.247857381
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Colon mucosal
The Specific Disease	Ulcerative colitis
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 0.079050122; Fold-change: 0.145791558; Z-score: 0.69781347
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section Download Antigen expression data of patients in the disease section of the tissue

Differential expression pattern of antigen in diseases
The Studied Tissue	Rectal colon
The Specific Disease	Irritable bowel syndrome
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.120280573; Fold-change: 0.120392858; Z-score: 0.243809122
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Skin
The Specific Disease	Atopic dermatitis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 1.34E-05; Fold-change: 0.311605605; Z-score: 1.998211704
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Skin
The Specific Disease	Psoriasis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 1.24E-17; Fold-change: 0.419760129; Z-score: 1.183735108
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 0.194849088; Fold-change: -0.195444781; Z-score: -0.387260543
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Skin
The Specific Disease	Vitiligo
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.00727397; Fold-change: 0.330217246; Z-score: 1.286261832
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Skin from scalp
The Specific Disease	Alopecia
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 3.14E-05; Fold-change: 0.478527635; Z-score: 0.879445666
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Skin
The Specific Disease	Sensitive skin
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.71356841; Fold-change: 0.084741045; Z-score: 0.229491156
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Synovial
The Specific Disease	Osteoarthritis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.493273716; Fold-change: 0.024317374; Z-score: 0.086415161
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Peripheral blood
The Specific Disease	Arthropathy
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.371598173; Fold-change: -0.081340319; Z-score: -0.333159533
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Peripheral blood
The Specific Disease	Arthritis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.628217594; Fold-change: -0.192908009; Z-score: -0.493154757
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Synovial
The Specific Disease	Rheumatoid arthritis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.737571172; Fold-change: -0.074136388; Z-score: -0.155214612
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Pheripheral blood
The Specific Disease	Ankylosing spondylitis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.697442032; Fold-change: -0.151099456; Z-score: -0.395783002
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Bone marrow
The Specific Disease	Osteoporosis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.214341067; Fold-change: 0.085145745; Z-score: 0.874660799
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Endometrium
The Specific Disease	Endometriosis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.798524401; Fold-change: 0.079632476; Z-score: 0.200925358
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Bladder
The Specific Disease	Interstitial cystitis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 3.57E-05; Fold-change: 1.057527414; Z-score: 5.609219886
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Myometrium
The Specific Disease	Preterm birth
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.626358256; Fold-change: -0.066604281; Z-score: -0.352169847
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Bone marrow
The Specific Disease	Acute myelocytic leukemia
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.304434207; Fold-change: 0.114447146; Z-score: 0.109556545
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Bone marrow
The Specific Disease	Myeloma
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.166334521; Fold-change: -0.140229567; Z-score: -0.646975638
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual
The Studied Tissue	Peripheral blood
The Specific Disease	Myeloma
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.769685451; Fold-change: 0.279815469; Z-score: 0.184367466
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Oral
The Specific Disease	Oral cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.109646061; Fold-change: -0.004452398; Z-score: -0.012017893
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 8.00E-07; Fold-change: 0.274530081; Z-score: 0.626461649
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Esophagus
The Specific Disease	Esophagal cancer
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 0.279552637; Fold-change: -0.210955306; Z-score: -0.38514481
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section Download Antigen expression data of patients in the disease section of the tissue

Differential expression pattern of antigen in diseases
The Studied Tissue	Rectal colon
The Specific Disease	Rectal cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.028076561; Fold-change: 0.269502274; Z-score: 1.243180267
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 0.33688187; Fold-change: 0.077960489; Z-score: 0.195624051
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Skin
The Specific Disease	Skin cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.010575505; Fold-change: 0.086190732; Z-score: 0.192054425
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 0.000569382; Fold-change: -0.243836254; Z-score: -0.482491237
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Kidney
The Specific Disease	Renal cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.814390904; Fold-change: -0.134704328; Z-score: -0.303195569
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 5.73E-15; Fold-change: -0.709841118; Z-score: -1.767443659
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Urothelium
The Specific Disease	Ureter cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.337716605; Fold-change: -0.084136014; Z-score: -0.538046299
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Adipose
The Specific Disease	Simpson golabi behmel syndrome
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.233584746; Fold-change: 0.131054062; Z-score: 0.892035521
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Perituberal
The Specific Disease	Tuberous sclerosis complex
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.050488736; Fold-change: 0.471204108; Z-score: 6.992460024
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Bone marrow
The Specific Disease	Anemia
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.870378986; Fold-change: -0.185513813; Z-score: -0.181656124
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Peripheral blood
The Specific Disease	Sickle cell disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.414548872; Fold-change: -0.115326288; Z-score: -1.134554963
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Whole blood
The Specific Disease	Thrombocythemia
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.390943814; Fold-change: -0.002738163; Z-score: -0.014061443
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Whole blood
The Specific Disease	Scleroderma
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 9.32E-05; Fold-change: 0.321721118; Z-score: 1.933453028
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Salivary gland
The Specific Disease	Sjogren syndrome
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.036331763; Fold-change: 0.127227665; Z-score: 1.035143496
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 0.839484879; Fold-change: -0.036780888; Z-score: -0.132612418
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Peripheral blood
The Specific Disease	Behcet disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.397490094; Fold-change: -0.00530742; Z-score: -0.002542468
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Whole blood
The Specific Disease	Autosomal dominant monocytopenia
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.143294442; Fold-change: 0.324021578; Z-score: 0.628366458
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Liver
The Specific Disease	Type 2 diabetes
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.985855327; Fold-change: -0.04773752; Z-score: -0.227978829
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Vastus lateralis muscle
The Specific Disease	Polycystic ovary syndrome
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.516559062; Fold-change: 0.08801338; Z-score: 1.02660381
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Subcutaneous Adipose
The Specific Disease	Obesity
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.375275513; Fold-change: 0.027234351; Z-score: 0.126291961
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Biceps muscle
The Specific Disease	Pompe disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.536854944; Fold-change: 0.028003288; Z-score: 0.078739417
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Whole blood
The Specific Disease	Batten disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.297107134; Fold-change: 0.164538722; Z-score: 0.373904003
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Whole blood
The Specific Disease	Autism
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.828972719; Fold-change: -0.035494177; Z-score: -0.113592514
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Whole blood
The Specific Disease	Anxiety disorder
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.144220757; Fold-change: 0.175343964; Z-score: 0.554814277
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Substantia nigra
The Specific Disease	Parkinson disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.496309707; Fold-change: 0.017211378; Z-score: 0.132533662
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Whole blood
The Specific Disease	Huntington disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.061004888; Fold-change: 0.293274389; Z-score: 0.963304295
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Entorhinal cortex
The Specific Disease	Alzheimer disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.873751912; Fold-change: 0.014436078; Z-score: 0.084585465
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Whole blood
The Specific Disease	Seizure
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.188990295; Fold-change: -0.089439592; Z-score: -0.238914005
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Skin
The Specific Disease	Lateral sclerosis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.264001064; Fold-change: 0.12222219; Z-score: 0.734832414
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual
The Studied Tissue	Cervical spinal cord
The Specific Disease	Lateral sclerosis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.851328013; Fold-change: 0.051401357; Z-score: 0.27264405
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Muscle
The Specific Disease	Muscular atrophy
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.61890363; Fold-change: 0.024178289; Z-score: 0.108658506
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Muscle
The Specific Disease	Myopathy
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.030661265; Fold-change: 0.056025193; Z-score: 0.324426796
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Ref 1	Study to Evaluate Adverse Events and Change in Disease Activity in Participants Between 18 to 75 Years of Age Treated With Subcutaneous (SC) Injections of ABBV-154 for Moderately to Severely Active Rheumatoid Arthritis (RA); NCT04888585,
Ref 2	Introduction to basic information on ADC drug adalimumab fosimdesonide.
Ref 3	Steroid conjugate; 2022-06-30.
Ref 4	Zyngenia biotherapeutics company program bi-specific anti-TNFalpha/Ang2 Zybodies.
Ref 5	Steroid conjugate; 2022-08-18.
Ref 6	Steroid compound and conjugate thereof; 2023-03-02.
Ref 7	Covalent linkers in antibody-drug conjugates and methods of making and using the same.