Antigen Information

General Information of This Antigen

Antigen ID	TAR0MSWGX
Antigen Name	Tumor necrosis factor (TNF)
Gene Name	TNF
Gene ID	7124
Synonym	TNFA; TNFSF2; Cachectin;TNF-alpha;Tumor necrosis factor ligand superfamily member 2
Sequence	MSTESMIRDVELAEEALPKKTGGPQGSRRCLFLSLFSFLIVAGATTLFCLLHFGVIGPQR EEFPRDLSLISPLAQAVRSSSRTPSDKPVAHVVANPQAEGQLQWLNRRANALLANGVELR DNQLVVPSEGLYLIYSQVLFKGQGCPSTHVLLTHTISRIAVSYQTKVNLLSAIKSPCQRE TPEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINRPDYLDFAESGQVYFGIIAL Click to Show/Hide
Family	Tumor necrosis factor family
Function	Cytokine that binds to TNFRSF1A/TNFR1 and TNFRSF1B/TNFBR. It is mainly secreted by macrophages and can induce cell death of certain tumor cell lines. It is potent pyrogen causing fever by direct action or by stimulation of interleukin-1 secretion and is implicated in the induction of cachexia, Under certain conditions it can stimulate cell proliferation and induce cell differentiation. Impairs regulatory T- cells (Treg) function in individuals with rheumatoid arthritis via FOXP3 dephosphorylation. Up-regulates the expression of protein phosphatase 1 (PP1), which dephosphorylates the key 'Ser-418' residue of FOXP3, thereby inactivating FOXP3 and rendering Treg cells functionally defective. Key mediator of cell death in the anticancer action of BCG-stimulated neutrophils in combination with DIABLO/SMAC mimetic in the RT4v6 bladder cancer cell line. Induces insulin resistance in adipocytes via inhibition of insulin-induced IRS1 tyrosine phosphorylation and insulin-induced glucose uptake. Induces GKAP42 protein degradation in adipocytes which is partially responsible for TNF-induced insulin resistance. Plays a role in angiogenesis by inducing VEGF production synergistically with IL1B and IL6. Click to Show/Hide
Uniprot Entry	TNFA_HUMAN
HGNC ID	HGNC:11892
KEGG ID	hsa:7124

Each Antibody-drug Conjuate AND It's Component Related to This Antigen

Full List of The ADC Related to This Antigen

Adalimumab

Antibody Info

ADC Info	ADC Name	Payload	Target	Linker	Ref
ADC Info	ABBV-3373	Glucocorticoid receptor modulator	Glucocorticoid receptor (NR3C1)	MP-Ala-Ala
ADC Info	ABBV-154	Glucocorticoid receptor modulator	Glucocorticoid receptor (NR3C1)	Formyl-Gly-Glu
ADC Info	Adalimumab/anti-Ang2 Zybody	Angiopep-2 TFA	Undisclosed	Undisclosed	[1]
ADC Info	Adalimumab fosimdesonide	SGD-1882	Human Deoxyribonucleic acid (hDNA)	Undisclosed	[2]
ADC Info	WO2022171101A1 ADC-45	WO2022171101A1 ADC-45 payload	Undisclosed	WO2022171101A1 ADC-45 linker	[3]
ADC Info	WO2022171101A1 ADC-48	WO2022171101A1 ADC-48 payload	Undisclosed	WO2022171101A1 ADC-48 linker	[3]
ADC Info	WO2023025248A1 ADC-56	WO2023025248A1 ADC-56 payload	Undisclosed	WO2023025248A1 ADC-56 linker	[4]
ADC Info	WO2022135332A1 1-9	WO2022135332A1_1-9 payload	Undisclosed	WO2022135332A1_1-9 linker	[5]
ADC Info	WO2022135332A1 1-10	WO2022135332A1_1-10 payload	Undisclosed	WO2022135332A1_1-10 linker	[5]
ADC Info	WO2022135332A1 1-11	WO2022135332A1_1-11 payload	Undisclosed	WO2022135332A1_1-11 linker	[5]
ADC Info	WO2022135332A1 1-13	WO2022135332A1_1-13 payload	Undisclosed	WO2022135332A1_1-13 linker	[5]
ADC Info	Adalimumab-Compound 9	Mertansine DM1	Microtubule (MT)	Adalimumab-Compound 9 linker	[6]
ADC Info	Adalimumab-Compound 17	Mertansine DM4	Microtubule (MT)	Adalimumab-Compound 17 linker	[6]
ADC Info	Adalimumab-Compound 25	Monomethyl auristatin E	Microtubule (MT)	Adalimumab-Compound 25 linker	[6]
ADC Info	Adalimumab-Compound 31	Auristatin 0101	Microtubule (MT)	Adalimumab-Compound 31 linker	[6]
ADC Info	Adalimumab-Compound 36	Monomethyl auristatin E	Microtubule (MT)	Adalimumab-Compound 36 linker	[6]
ADC Info	Adalimumab-Compound 43	PBD dimer	Human Deoxyribonucleic acid (hDNA)	Adalimumab-Compound 43 linker	[6]
ADC Info	Adalimumab-Compound 49	PBD dimer	Human Deoxyribonucleic acid (hDNA)	Adalimumab-Compound 49 linker	[6]
ADC Info	Adalimumab-Compound 55	Mertansine DM1	Microtubule (MT)	Adalimumab-Compound 55 linker	[6]
ADC Info	Adalimumab-Compound 59	Mertansine DM4	Microtubule (MT)	Adalimumab-Compound 59 linker	[6]
ADC Info	Adalimumab-Compound 64	Monomethyl auristatin E	Microtubule (MT)	Adalimumab-Compound 64 linker	[6]
ADC Info	Adalimumab-Compound 69	Monomethyl auristatin E	Microtubule (MT)	Adalimumab-Compound 69 linker	[6]
ADC Info	Adalimumab-Compound 74	PBD dimer	Human Deoxyribonucleic acid (hDNA)	Adalimumab-Compound 74 linker	[6]
ADC Info	Adalimumab-Compound 75	Monomethyl auristatin E	Microtubule (MT)	Adalimumab-Compound 75 linker	[6]
ADC Info	Adalimumab-Compound 76	Monomethyl auristatin E	Microtubule (MT)	Adalimumab-Compound 76 linker	[6]
ADC Info	Adalimumab-Compound 77	Mertansine DM1	Microtubule (MT)	Adalimumab-Compound 77 linker	[6]
ADC Info	Adalimumab-Compound 78	Auristatin 0101	Microtubule (MT)	Adalimumab-Compound 78 linker	[6]
ADC Info	Adalimumab-Compound 79	Auristatin 0101	Microtubule (MT)	Adalimumab-Compound 79 linker	[6]
ADC Info	Adalimumab-Compound 80	Mertansine DM4	Microtubule (MT)	Adalimumab-Compound 80 linker	[6]
ADC Info	Anti-TNFalpha_VCGP-Dex	Dexamethasone	Glucocorticoid receptor (NR3C1)	Mal-ValCitGlyPro-OH	[7]

Golimumab

Antibody Info

ADC Info	ADC Name	Payload	Target	Linker	Ref
ADC Info	Golimumab-Compound 9	Mertansine DM1	Microtubule (MT)	Golimumab-Compound 9 linker	[6]
ADC Info	Golimumab-Compound 17	Mertansine DM4	Microtubule (MT)	Golimumab-Compound 17 linker	[6]
ADC Info	Golimumab-Compound 25	Monomethyl auristatin E	Microtubule (MT)	Golimumab-Compound 25 linker	[6]
ADC Info	Golimumab-Compound 31	Auristatin 0101	Microtubule (MT)	Golimumab-Compound 31 linker	[6]
ADC Info	Golimumab-Compound 36	Monomethyl auristatin E	Microtubule (MT)	Golimumab-Compound 36 linker	[6]
ADC Info	Golimumab-Compound 43	PBD dimer	Human Deoxyribonucleic acid (hDNA)	Golimumab-Compound 43 linker	[6]
ADC Info	Golimumab-Compound 49	PBD dimer	Human Deoxyribonucleic acid (hDNA)	Golimumab-Compound 49 linker	[6]
ADC Info	Golimumab-Compound 55	Mertansine DM1	Microtubule (MT)	Golimumab-Compound 55 linker	[6]
ADC Info	Golimumab-Compound 59	Mertansine DM4	Microtubule (MT)	Golimumab-Compound 59 linker	[6]
ADC Info	Golimumab-Compound 64	Monomethyl auristatin E	Microtubule (MT)	Golimumab-Compound 64 linker	[6]
ADC Info	Golimumab-Compound 69	Monomethyl auristatin E	Microtubule (MT)	Golimumab-Compound 69 linker	[6]
ADC Info	Golimumab-Compound 74	PBD dimer	Human Deoxyribonucleic acid (hDNA)	Golimumab-Compound 74 linker	[6]
ADC Info	Golimumab-Compound 75	Monomethyl auristatin E	Microtubule (MT)	Golimumab-Compound 75 linker	[6]
ADC Info	Golimumab-Compound 76	Monomethyl auristatin E	Microtubule (MT)	Golimumab-Compound 76 linker	[6]
ADC Info	Golimumab-Compound 77	Mertansine DM1	Microtubule (MT)	Golimumab-Compound 77 linker	[6]
ADC Info	Golimumab-Compound 78	Auristatin 0101	Microtubule (MT)	Golimumab-Compound 78 linker	[6]
ADC Info	Golimumab-Compound 79	Auristatin 0101	Microtubule (MT)	Golimumab-Compound 79 linker	[6]
ADC Info	Golimumab-Compound 80	Mertansine DM4	Microtubule (MT)	Golimumab-Compound 80 linker	[6]

hu a-TNF

Antibody Info

ADC Info	ADC Name	Payload	Target	Linker	Ref
ADC Info	38780432 ADC 8	Cpd 6	Undisclosed	BrAc-Ala-Ala	[8]

Human anti-TNF

Antibody Info

ADC Info	ADC Name	Payload	Target	Linker	Ref
ADC Info	37379257 ADC 5	Undisclosed	Undisclosed	MP-Ala-Ala	[9]
ADC Info	37379257 ADC 6	Undisclosed	Undisclosed	M-Gly-Ala-Ala	[9]
ADC Info	37379257 ADC 17	Undisclosed	Undisclosed	M-Gly-Ala-Ala	[9]
ADC Info	37379257 ADC 18	Undisclosed	Undisclosed	M-Gly-Ala	[9]
ADC Info	37379257 ADC 19	Undisclosed	Undisclosed	M-Gly-GluF	[9]

Infliximab

Antibody Info

ADC Info	ADC Name	Payload	Target	Linker	Ref
ADC Info	Infliximab-Compound 9	Mertansine DM1	Microtubule (MT)	Infliximab-Compound 9 linker	[6]
ADC Info	Infliximab-Compound 17	Mertansine DM4	Microtubule (MT)	Infliximab-Compound 17 linker	[6]
ADC Info	Infliximab-Compound 25	Monomethyl auristatin E	Microtubule (MT)	Infliximab-Compound 25 linker	[6]
ADC Info	Infliximab-Compound 31	Auristatin 0101	Microtubule (MT)	Infliximab-Compound 31 linker	[6]
ADC Info	Infliximab-Compound 36	Monomethyl auristatin E	Microtubule (MT)	Infliximab-Compound 36 linker	[6]
ADC Info	Infliximab-Compound 43	PBD dimer	Human Deoxyribonucleic acid (hDNA)	Infliximab-Compound 43 linker	[6]
ADC Info	Infliximab-Compound 49	PBD dimer	Human Deoxyribonucleic acid (hDNA)	Infliximab-Compound 49 linker	[6]
ADC Info	Infliximab-Compound 55	Mertansine DM1	Microtubule (MT)	Infliximab-Compound 55 linker	[6]
ADC Info	Infliximab-Compound 59	Mertansine DM4	Microtubule (MT)	Infliximab-Compound 59 linker	[6]
ADC Info	Infliximab-Compound 64	Monomethyl auristatin E	Microtubule (MT)	Infliximab-Compound 64 linker	[6]
ADC Info	Infliximab-Compound 69	Monomethyl auristatin E	Microtubule (MT)	Infliximab-Compound 69 linker	[6]
ADC Info	Infliximab-Compound 74	PBD dimer	Human Deoxyribonucleic acid (hDNA)	Infliximab-Compound 74 linker	[6]
ADC Info	Infliximab-Compound 75	Monomethyl auristatin E	Microtubule (MT)	Infliximab-Compound 75 linker	[6]
ADC Info	Infliximab-Compound 76	Monomethyl auristatin E	Microtubule (MT)	Infliximab-Compound 76 linker	[6]
ADC Info	Infliximab-Compound 77	Mertansine DM1	Microtubule (MT)	Infliximab-Compound 77 linker	[6]
ADC Info	Infliximab-Compound 78	Auristatin 0101	Microtubule (MT)	Infliximab-Compound 78 linker	[6]
ADC Info	Infliximab-Compound 79	Auristatin 0101	Microtubule (MT)	Infliximab-Compound 79 linker	[6]
ADC Info	Infliximab-Compound 80	Mertansine DM4	Microtubule (MT)	Infliximab-Compound 80 linker	[6]

mAb-C

Antibody Info

ADC Info	ADC Name	Payload	Target	Linker	Ref
ADC Info	WO2024140927A1-ADC-C (DAR2)	Monomethyl auristatin E	Microtubule (MT)	Mc-Val-Cit-PABC	[10]
ADC Info	WO2024140927A1-ADC-C (DAR4)	Monomethyl auristatin E	Microtubule (MT)	Mc-Val-Cit-PABC	[10]
ADC Info	WO2024140927A1-ADC-C (DAR7)	Monomethyl auristatin E	Microtubule (MT)	Mc-Val-Cit-PABC	[10]

Mouse anti-TNF

Antibody Info

ADC Info	ADC Name	Payload	Target	Linker	Ref
ADC Info	37379257 ADC 3	Undisclosed	Undisclosed	MP-Ala-Ala	[9]
ADC Info	37379257 ADC 4	Undisclosed	Undisclosed	M-Gly-Ala-Ala	[9]
ADC Info	37379257 ADC 14	Undisclosed	Undisclosed	M-Gly-Ala-Ala	[9]
ADC Info	37379257 ADC 15	Undisclosed	Undisclosed	M-Gly-Ala	[9]
ADC Info	37379257 ADC 16	Undisclosed	Undisclosed	M-Gly-GluF	[9]

mu a-TNF

Antibody Info

ADC Info	ADC Name	Payload	Target	Linker	Ref
ADC Info	38780432 ADC 1	Cpd 2	Undisclosed	MP-Ala-Ala	[8]
ADC Info	38780432 ADC 2	Cpd 6	Undisclosed	M-Gly-GluF	[8]
ADC Info	38780432 ADC 3	Cpd 4	Undisclosed	M-Gly-GluF	[8]
ADC Info	38780432 ADC 4	Cpd 6	Undisclosed	M-Gly-Ala-Ala	[8]
ADC Info	38780432 ADC 5	Cpd 6	Undisclosed	BrAc-Ala-Ala	[8]
ADC Info	38780432 ADC 6	Cpd 6	Undisclosed	BrAc-Gly-Glu	[8]
ADC Info	38780432 ADC 7	Cpd 6	Undisclosed	BrAc-Ala-Glu	[8]

undisclosed

Antibody Info

ADC Info	ADC Name	Payload	Target	Linker	Ref
ADC Info	38283215 ADC 1	GRM payload C1	Undisclosed	Ala-Ala linker	[11]
ADC Info	38283215 ADC 2	GRM payload C1	Undisclosed	Ala-Arg linker	[11]
ADC Info	38283215 ADC 3	GRM payload C1	Undisclosed	Ala-Gln linker	[11]
ADC Info	38283215 ADC 4	GRM payload C1	Undisclosed	Ala-Glu linker	[11]
ADC Info	38283215 ADC 5	GRM payload C1	Undisclosed	Ala-Gly linker	[11]
ADC Info	38283215 ADC 6	GRM payload C1	Undisclosed	Ala-His linker	[11]
ADC Info	38283215 ADC 7	GRM payload C1	Undisclosed	Ala-Lys linker	[11]
ADC Info	38283215 ADC 8	GRM payload C1	Undisclosed	Ala-Ser linker	[11]
ADC Info	38283215 ADC 9	GRM payload C1	Undisclosed	Gly-Ala linker	[11]
ADC Info	38283215 ADC 10	GRM payload C1	Undisclosed	Gly-Gln linker	[11]
ADC Info	38283215 ADC 11	GRM payload C1	Undisclosed	Gly-Glu linker	[11]
ADC Info	38283215 ADC 12	GRM payload C1	Undisclosed	Gly-Gly linker	[11]
ADC Info	38283215 ADC 13	GRM payload C1	Undisclosed	Gly-Ser linker	[11]
ADC Info	38283215 ADC 14	GRM payload C1	Undisclosed	Phe-Lys linker	[11]
ADC Info	38283215 ADC 15	GRM payload C1	Undisclosed	Ser-Ala linker	[11]
ADC Info	38283215 ADC 16	GRM payload C1	Undisclosed	Ser-Asn linker	[11]
ADC Info	38283215 ADC 17	GRM payload C1	Undisclosed	Ser-Gln linker	[11]
ADC Info	38283215 ADC 18	GRM payload C1	Undisclosed	Ser-Glu linker	[11]
ADC Info	38283215 ADC 19	GRM payload C1	Undisclosed	Ser-Gly linker	[11]
ADC Info	38283215 ADC 20	GRM payload C1	Undisclosed	Val-Ala linker	[11]
ADC Info	38283215 ADC 21	GRM payload C1	Undisclosed	Val-Arg linker	[11]
ADC Info	38283215 ADC 22	GRM payload C1	Undisclosed	Val-Cit linker	[11]
ADC Info	38283215 ADC 23	GRM payload C1	Undisclosed	Val-Asn linker	[11]
ADC Info	38283215 ADC 24	GRM payload C1	Undisclosed	Val-Gln linker	[11]
ADC Info	38283215 ADC 25	GRM payload C1	Undisclosed	Val-Glu linker	[11]
ADC Info	38283215 ADC 26	GRM payload C1	Undisclosed	Val-Gly linker	[11]
ADC Info	38283215 ADC 27	GRM payload C1	Undisclosed	Val-Ser linker	[11]
ADC Info	38283215 ADC 28	GRM payload C1	Undisclosed	Ala-Ala linker	[11]
ADC Info	38283215 ADC 29	GRM payload C1	Undisclosed	Ala-Arg linker	[11]
ADC Info	38283215 ADC 30	GRM payload C1	Undisclosed	Ala-Gln linker	[11]
ADC Info	38283215 ADC 31	GRM payload C1	Undisclosed	Ala-Glu linker	[11]
ADC Info	38283215 ADC 32	GRM payload C1	Undisclosed	Ala-Gly linker	[11]
ADC Info	38283215 ADC 33	GRM payload C1	Undisclosed	Ala-His linker	[11]
ADC Info	38283215 ADC 34	GRM payload C1	Undisclosed	Ala-Ser linker	[11]
ADC Info	38283215 ADC 35	GRM payload C1	Undisclosed	Ala-Asn linker	[11]
ADC Info	38283215 ADC 36	GRM payload C1	Undisclosed	Ala-Val linker	[11]
ADC Info	38283215 ADC 37	GRM payload C1	Undisclosed	Ala-Phe linker	[11]
ADC Info	38283215 ADC 38	GRM payload C1	Undisclosed	Gly-Ala linker	[11]
ADC Info	38283215 ADC 39	GRM payload C1	Undisclosed	Gly-Gln linker	[11]
ADC Info	38283215 ADC 40	GRM payload C1	Undisclosed	Gly-Glu linker	[11]
ADC Info	38283215 ADC 41	GRM payload C1	Undisclosed	Gly-Gly linker	[11]
ADC Info	38283215 ADC 42	GRM payload C1	Undisclosed	Gly-Ser linker	[11]
ADC Info	38283215 ADC 43	GRM payload C1	Undisclosed	Phe-Lys linker	[11]
ADC Info	38283215 ADC 44	GRM payload C1	Undisclosed	Ser-Ala linker	[11]
ADC Info	38283215 ADC 45	GRM payload C1	Undisclosed	Ser-Asn linker	[11]
ADC Info	38283215 ADC 46	GRM payload C1	Undisclosed	Ser-Gln linker	[11]
ADC Info	38283215 ADC 47	GRM payload C1	Undisclosed	Ser-Glu linker	[11]
ADC Info	38283215 ADC 48	GRM payload C1	Undisclosed	Ser-Gly linker	[11]
ADC Info	38283215 ADC 49	GRM payload C1	Undisclosed	Val-Ala linker	[11]
ADC Info	38283215 ADC 50	GRM payload C1	Undisclosed	Val-Arg linker	[11]
ADC Info	38283215 ADC 51	GRM payload C1	Undisclosed	Val-Cit linker	[11]
ADC Info	38283215 ADC 52	GRM payload C1	Undisclosed	Val-Asn linker	[11]
ADC Info	38283215 ADC 53	GRM payload C1	Undisclosed	Val-Gln linker	[11]
ADC Info	38283215 ADC 54	GRM payload C1	Undisclosed	Val-Glu linker	[11]
ADC Info	38283215 ADC 55	GRM payload C1	Undisclosed	Val-Gly linker	[11]
ADC Info	38283215 ADC 56	GRM payload C1	Undisclosed	Val-Ser linker	[11]

References

Ref 1	Zyngenia biotherapeutics company program bi-specific anti-TNFalpha/Ang2 Zybodies.
Ref 2	Introduction to basic information on ADC drug adalimumab fosimdesonide.
Ref 3	Steroid conjugate; 2022-08-18.
Ref 4	Steroid compound and conjugate thereof; 2023-03-02.
Ref 5	Steroid conjugate; 2022-06-30.
Ref 6	Covalent linkers in antibody-drug conjugates and methods of making and using the same.
Ref 7	ValCitGlyPro-dexamethasone antibody conjugates selectively suppress the activation of human monocytes
Ref 8	Anti-TNF Thioester Glucocorticoid Antibody-Drug Conjugate Fully Inhibits Inflammation with Minimal Effect on Systemic Corticosterone Levels in a Mouse Arthritis Model
Ref 9	Optimization of Drug-Linker to Enable Long-term Storage of Antibody-Drug Conjugate for Subcutaneous Dosing
Ref 10	Use of hydroxypropyl-β-cyclodextrin in stabilizing antibody-drug conjugate formulations
Ref 11	Impact of dipeptide on ADC physicochemical properties and efficacy identifies Ala-Ala as the optimal dipeptide

Antigen Information

Citation

Visitor Map

Correspondence

Prof. Feng ZHU (zhufeng@zju.edu.cn)

Prof. Xiaowu DONG (dongxw@zju.edu.cn)

Prof. Luo FANG (fangluo@zjcc.org.cn)