General Information of This Antigen
Antigen ID
TAR0MSWGX
Antigen Name
Tumor necrosis factor (TNF)
Gene Name
TNF
Gene ID
7124
Synonym
TNFA; TNFSF2; Cachectin;TNF-alpha;Tumor necrosis factor ligand superfamily member 2
Sequence
MSTESMIRDVELAEEALPKKTGGPQGSRRCLFLSLFSFLIVAGATTLFCLLHFGVIGPQR
EEFPRDLSLISPLAQAVRSSSRTPSDKPVAHVVANPQAEGQLQWLNRRANALLANGVELR
DNQLVVPSEGLYLIYSQVLFKGQGCPSTHVLLTHTISRIAVSYQTKVNLLSAIKSPCQRE
TPEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINRPDYLDFAESGQVYFGIIAL

    Click to Show/Hide
Family
Tumor necrosis factor family
Function
Cytokine that binds to TNFRSF1A/TNFR1 and TNFRSF1B/TNFBR. It is mainly secreted by macrophages and can induce cell death of certain tumor cell lines. It is potent pyrogen causing fever by direct action or by stimulation of interleukin-1 secretion and is implicated in the induction of cachexia, Under certain conditions it can stimulate cell proliferation and induce cell differentiation. Impairs regulatory T- cells (Treg) function in individuals with rheumatoid arthritis via FOXP3 dephosphorylation. Up-regulates the expression of protein phosphatase 1 (PP1), which dephosphorylates the key 'Ser-418' residue of FOXP3, thereby inactivating FOXP3 and rendering Treg cells functionally defective. Key mediator of cell death in the anticancer action of BCG-stimulated neutrophils in combination with DIABLO/SMAC mimetic in the RT4v6 bladder cancer cell line. Induces insulin resistance in adipocytes via inhibition of insulin-induced IRS1 tyrosine phosphorylation and insulin-induced glucose uptake. Induces GKAP42 protein degradation in adipocytes which is partially responsible for TNF-induced insulin resistance. Plays a role in angiogenesis by inducing VEGF production synergistically with IL1B and IL6.

    Click to Show/Hide
Uniprot Entry
TNFA_HUMAN
HGNC ID
HGNC:11892
KEGG ID
hsa:7124
Each Antibody-drug Conjuate AND It's Component Related to This Antigen
Full List of The ADC Related to This Antigen
Adalimumab
ADC Info ADC Name Payload Target Linker Ref
ABBV-154
Glucocorticoid receptor modulator
Glucocorticoid receptor (NR3C1)
Formyl-Gly-Glu
[1]
Adalimumab fosimdesonide
SGD-1882
Human Deoxyribonucleic acid (hDNA)
Undisclosed
[2]
Adalimumab/anti-Ang2 Zybody
Angiopep-2 TFA
Undisclosed
Undisclosed
[3]
Adalimumab-Compound 17
Mertansine DM4
Microtubule (MT)
Adalimumab-Compound 17 linker
[4]
Adalimumab-Compound 25
Monomethyl auristatin E
Microtubule (MT)
Adalimumab-Compound 25 linker
[4]
Adalimumab-Compound 31
Auristatin 0101
Microtubule (MT)
Adalimumab-Compound 31 linker
[4]
Adalimumab-Compound 36
Monomethyl auristatin E
Microtubule (MT)
Adalimumab-Compound 36 linker
[4]
Adalimumab-Compound 43
PBD dimer
Human Deoxyribonucleic acid (hDNA)
Adalimumab-Compound 43 linker
[4]
Adalimumab-Compound 49
PBD dimer
Human Deoxyribonucleic acid (hDNA)
Adalimumab-Compound 49 linker
[4]
Adalimumab-Compound 55
Mertansine DM1
Microtubule (MT)
Adalimumab-Compound 55 linker
[4]
Adalimumab-Compound 59
Mertansine DM4
Microtubule (MT)
Adalimumab-Compound 59 linker
[4]
Adalimumab-Compound 64
Monomethyl auristatin E
Microtubule (MT)
Adalimumab-Compound 64 linker
[4]
Adalimumab-Compound 69
Monomethyl auristatin E
Microtubule (MT)
Adalimumab-Compound 69 linker
[4]
Adalimumab-Compound 74
PBD dimer
Human Deoxyribonucleic acid (hDNA)
Adalimumab-Compound 74 linker
[4]
Adalimumab-Compound 75
Monomethyl auristatin E
Microtubule (MT)
Adalimumab-Compound 75 linker
[4]
Adalimumab-Compound 76
Monomethyl auristatin E
Microtubule (MT)
Adalimumab-Compound 76 linker
[4]
Adalimumab-Compound 77
Mertansine DM1
Microtubule (MT)
Adalimumab-Compound 77 linker
[4]
Adalimumab-Compound 78
Auristatin 0101
Microtubule (MT)
Adalimumab-Compound 78 linker
[4]
Adalimumab-Compound 79
Auristatin 0101
Microtubule (MT)
Adalimumab-Compound 79 linker
[4]
Adalimumab-Compound 80
Mertansine DM4
Microtubule (MT)
Adalimumab-Compound 80 linker
[4]
Adalimumab-Compound 9
Mertansine DM1
Microtubule (MT)
Adalimumab-Compound 9 linker
[4]
WO2022135332A1 1-10
WO2022135332A1_1-10 payload
Undisclosed
WO2022135332A1_1-10 linker
[5]
WO2022135332A1 1-11
WO2022135332A1_1-11 payload
Undisclosed
WO2022135332A1_1-11 linker
[5]
WO2022135332A1 1-13
WO2022135332A1_1-13 payload
Undisclosed
WO2022135332A1_1-13 linker
[5]
WO2022135332A1 1-9
WO2022135332A1_1-9 payload
Undisclosed
WO2022135332A1_1-9 linker
[5]
WO2022171101A1 ADC-45
WO2022171101A1 ADC-45 payload
Undisclosed
WO2022171101A1 ADC-45 linker
[6]
WO2022171101A1 ADC-48
WO2022171101A1 ADC-48 payload
Undisclosed
WO2022171101A1 ADC-48 linker
[6]
WO2023025248A1 ADC-56
WO2023025248A1 ADC-56 payload
Undisclosed
WO2023025248A1 ADC-56 linker
[7]
Golimumab
ADC Info ADC Name Payload Target Linker Ref
Golimumab-Compound 17
Mertansine DM4
Microtubule (MT)
Golimumab-Compound 17 linker
[4]
Golimumab-Compound 25
Monomethyl auristatin E
Microtubule (MT)
Golimumab-Compound 25 linker
[4]
Golimumab-Compound 31
Auristatin 0101
Microtubule (MT)
Golimumab-Compound 31 linker
[4]
Golimumab-Compound 36
Monomethyl auristatin E
Microtubule (MT)
Golimumab-Compound 36 linker
[4]
Golimumab-Compound 43
PBD dimer
Human Deoxyribonucleic acid (hDNA)
Golimumab-Compound 43 linker
[4]
Golimumab-Compound 49
PBD dimer
Human Deoxyribonucleic acid (hDNA)
Golimumab-Compound 49 linker
[4]
Golimumab-Compound 55
Mertansine DM1
Microtubule (MT)
Golimumab-Compound 55 linker
[4]
Golimumab-Compound 59
Mertansine DM4
Microtubule (MT)
Golimumab-Compound 59 linker
[4]
Golimumab-Compound 64
Monomethyl auristatin E
Microtubule (MT)
Golimumab-Compound 64 linker
[4]
Golimumab-Compound 69
Monomethyl auristatin E
Microtubule (MT)
Golimumab-Compound 69 linker
[4]
Golimumab-Compound 74
PBD dimer
Human Deoxyribonucleic acid (hDNA)
Golimumab-Compound 74 linker
[4]
Golimumab-Compound 75
Monomethyl auristatin E
Microtubule (MT)
Golimumab-Compound 75 linker
[4]
Golimumab-Compound 76
Monomethyl auristatin E
Microtubule (MT)
Golimumab-Compound 76 linker
[4]
Golimumab-Compound 77
Mertansine DM1
Microtubule (MT)
Golimumab-Compound 77 linker
[4]
Golimumab-Compound 78
Auristatin 0101
Microtubule (MT)
Golimumab-Compound 78 linker
[4]
Golimumab-Compound 79
Auristatin 0101
Microtubule (MT)
Golimumab-Compound 79 linker
[4]
Golimumab-Compound 80
Mertansine DM4
Microtubule (MT)
Golimumab-Compound 80 linker
[4]
Golimumab-Compound 9
Mertansine DM1
Microtubule (MT)
Golimumab-Compound 9 linker
[4]
Infliximab
ADC Info ADC Name Payload Target Linker Ref
Infliximab-Compound 17
Mertansine DM4
Microtubule (MT)
Infliximab-Compound 17 linker
[4]
Infliximab-Compound 25
Monomethyl auristatin E
Microtubule (MT)
Infliximab-Compound 25 linker
[4]
Infliximab-Compound 31
Auristatin 0101
Microtubule (MT)
Infliximab-Compound 31 linker
[4]
Infliximab-Compound 36
Monomethyl auristatin E
Microtubule (MT)
Infliximab-Compound 36 linker
[4]
Infliximab-Compound 43
PBD dimer
Human Deoxyribonucleic acid (hDNA)
Infliximab-Compound 43 linker
[4]
Infliximab-Compound 49
PBD dimer
Human Deoxyribonucleic acid (hDNA)
Infliximab-Compound 49 linker
[4]
Infliximab-Compound 55
Mertansine DM1
Microtubule (MT)
Infliximab-Compound 55 linker
[4]
Infliximab-Compound 59
Mertansine DM4
Microtubule (MT)
Infliximab-Compound 59 linker
[4]
Infliximab-Compound 64
Monomethyl auristatin E
Microtubule (MT)
Infliximab-Compound 64 linker
[4]
Infliximab-Compound 69
Monomethyl auristatin E
Microtubule (MT)
Infliximab-Compound 69 linker
[4]
Infliximab-Compound 74
PBD dimer
Human Deoxyribonucleic acid (hDNA)
Infliximab-Compound 74 linker
[4]
Infliximab-Compound 75
Monomethyl auristatin E
Microtubule (MT)
Infliximab-Compound 75 linker
[4]
Infliximab-Compound 76
Monomethyl auristatin E
Microtubule (MT)
Infliximab-Compound 76 linker
[4]
Infliximab-Compound 77
Mertansine DM1
Microtubule (MT)
Infliximab-Compound 77 linker
[4]
Infliximab-Compound 78
Auristatin 0101
Microtubule (MT)
Infliximab-Compound 78 linker
[4]
Infliximab-Compound 79
Auristatin 0101
Microtubule (MT)
Infliximab-Compound 79 linker
[4]
Infliximab-Compound 80
Mertansine DM4
Microtubule (MT)
Infliximab-Compound 80 linker
[4]
Infliximab-Compound 9
Mertansine DM1
Microtubule (MT)
Infliximab-Compound 9 linker
[4]
Tissue/Disease specific Abundances of This Antigen
Tissue specific Abundances of This Antigen
ICD Disease Classification 01
Click to Show/Hide the 1 Disease of This Class
Bacterial infection [ICD-11: 1A00-1C4Z]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Gingival
The Specific Disease Bacterial infection of gingival
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.094384156; Fold-change: 0.088870992; Z-score: 0.319430381
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 02
Click to Show/Hide the 22 Disease of This Class
Brain cancer [ICD-11: 2A00]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Brainstem
The Specific Disease Glioma
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.490428815; Fold-change: -0.404829408; Z-score: -1.238791153
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
The Studied Tissue White matter
The Specific Disease Glioma
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.401804072; Fold-change: -0.814121217; Z-score: -0.578536956
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
The Studied Tissue Brainstem
The Specific Disease Neuroectodermal tumor
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 9.43E-06; Fold-change: -1.4020002; Z-score: -2.629246036
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
The Studied Tissue Nervous
The Specific Disease Brain cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 1.89E-25; Fold-change: 0.257600928; Z-score: 0.638275929
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Chronic myeloid leukemia [ICD-11: 2A20]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Whole blood
The Specific Disease Polycythemia vera
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.001740536; Fold-change: 0.091678941; Z-score: 0.452834174
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
The Studied Tissue Whole blood
The Specific Disease Myelofibrosis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.00917976; Fold-change: 0.135449234; Z-score: 0.750610945
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
MyeloDysplastic syndromes [ICD-11: 2A37]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Bone marrow
The Specific Disease Myelodysplastic syndromes
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.382189312; Fold-change: 0.034827371; Z-score: 0.032876956
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.092004586; Fold-change: -2.156222525; Z-score: -1.023544878
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Lymphoma [ICD-11: 2A90- 2A85]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Tonsil
The Specific Disease Lymphoma
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.709296906; Fold-change: 0.147819378; Z-score: 0.283410846
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Gastric cancer [ICD-11: 2B72]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Gastric
The Specific Disease Gastric cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.264070609; Fold-change: 0.083955484; Z-score: 0.359492096
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 2.47E-08; Fold-change: 0.188297239; Z-score: 1.303986192
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Colon cancer [ICD-11: 2B90]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Colon
The Specific Disease Colon cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 1.90E-13; Fold-change: -0.266408977; Z-score: -0.835758008
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.488670982; Fold-change: -0.069850791; Z-score: -0.176844793
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Pancreatic cancer [ICD-11: 2C10]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Pancreas
The Specific Disease Pancreatic cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.059201359; Fold-change: -0.256655273; Z-score: -0.497992976
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.005633743; Fold-change: -0.234663117; Z-score: -0.574459695
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Liver cancer [ICD-11: 2C12]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Liver
The Specific Disease Liver cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 5.05E-10; Fold-change: -0.318529022; Z-score: -1.294904843
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 8.51E-12; Fold-change: -0.192774085; Z-score: -0.643185415
The Expression Level of Disease Section Compare with the Other Disease Section p-value: 0.294713471; Fold-change: -0.228366134; Z-score: -0.773687945
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Lung cancer [ICD-11: 2C25]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Lung
The Specific Disease Lung cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 2.20E-19; Fold-change: -0.430957377; Z-score: -0.902045624
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 8.14E-16; Fold-change: -0.491849878; Z-score: -1.013241801
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Melanoma [ICD-11: 2C30]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Skin
The Specific Disease Melanoma
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.940209347; Fold-change: -0.267524401; Z-score: -0.399095079
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Sarcoma [ICD-11: 2C35]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Muscle
The Specific Disease Sarcoma
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 8.79E-06; Fold-change: 0.032153522; Z-score: 0.124270956
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.108355798; Fold-change: -0.278324343; Z-score: -1.244625946
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Breast cancer [ICD-11: 2C60]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Breast
The Specific Disease Breast cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 4.75E-14; Fold-change: 0.124942795; Z-score: 0.350483629
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.001810869; Fold-change: 0.041745497; Z-score: 0.114625927
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Ovarian cancer [ICD-11: 2C73]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Ovarian
The Specific Disease Ovarian cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.051520581; Fold-change: 0.165943117; Z-score: 0.336145924
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.269528; Fold-change: 0.175491972; Z-score: 0.313545606
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Cervical cancer [ICD-11: 2C77]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Cervical
The Specific Disease Cervical cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.013907793; Fold-change: -0.09470984; Z-score: -0.478697297
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Uterine cancer [ICD-11: 2C78]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Endometrium
The Specific Disease Uterine cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.471161137; Fold-change: 0.008176641; Z-score: 0.012902469
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.550755391; Fold-change: -0.490287275; Z-score: -0.911780987
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Prostate cancer [ICD-11: 2C82]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Prostate
The Specific Disease Prostate cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.087867138; Fold-change: 0.067126467; Z-score: 0.110279122
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Bladder cancer [ICD-11: 2C94]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Bladder
The Specific Disease Bladder cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 4.62E-05; Fold-change: 0.347761324; Z-score: 2.140829881
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Retina cancer [ICD-11: 2D02]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Uvea
The Specific Disease Retinoblastoma tumor
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.042102937; Fold-change: 0.103691154; Z-score: 0.750739653
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Thyroid cancer [ICD-11: 2D10]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Thyroid
The Specific Disease Thyroid cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 2.94E-05; Fold-change: 0.215249743; Z-score: 0.471483504
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.005256362; Fold-change: 0.167457607; Z-score: 0.382735015
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Adrenal cancer [ICD-11: 2D11]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Adrenal cortex
The Specific Disease Adrenocortical carcinoma
The Expression Level of Disease Section Compare with the Other Disease Section p-value: 0.023094167; Fold-change: -0.131662047; Z-score: -0.969241606
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Head and neck cancer [ICD-11: 2D42]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Head and neck
The Specific Disease Head and neck cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 3.25E-06; Fold-change: 0.331190751; Z-score: 0.660675596
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Pituitary cancer [ICD-11: 2F37]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Pituitary
The Specific Disease Pituitary gonadotrope tumor
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.020041642; Fold-change: 0.12596528; Z-score: 0.859069802
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
The Studied Tissue Pituitary
The Specific Disease Pituitary cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.058183971; Fold-change: 0.236415435; Z-score: 0.662095845
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 03
Click to Show/Hide the 1 Disease of This Class
Thrombocytopenia [ICD-11: 3B64]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Whole blood
The Specific Disease Thrombocytopenia
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.741920164; Fold-change: -0.358397879; Z-score: -0.494455255
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 04
Click to Show/Hide the 2 Disease of This Class
Lupus erythematosus [ICD-11: 4A40]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Whole blood
The Specific Disease Lupus erythematosus
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.638713217; Fold-change: 0.124805593; Z-score: 0.131593117
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Autoimmune disease [ICD-11: 4A4Z]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Peripheral monocyte
The Specific Disease Autoimmune uveitis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.092722953; Fold-change: -0.353708643; Z-score: -0.327045982
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 05
Click to Show/Hide the 1 Disease of This Class
Hyperlipoproteinaemia [ICD-11: 5C80]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Whole blood
The Specific Disease Familial hypercholesterolemia
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.102878704; Fold-change: 0.336409243; Z-score: 1.087539184
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 06
Click to Show/Hide the 1 Disease of This Class
Schizophrenia [ICD-11: 6A20]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Superior temporal cortex
The Specific Disease Schizophrenia
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.561626399; Fold-change: 0.023977523; Z-score: 0.261247689
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 08
Click to Show/Hide the 3 Disease of This Class
Multiple sclerosis [ICD-11: 8A40]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Spinal cord
The Specific Disease Multiple sclerosis
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.686748986; Fold-change: -0.005163135; Z-score: -0.025797011
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
The Studied Tissue Plasmacytoid dendritic cells
The Specific Disease Multiple sclerosis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.017078793; Fold-change: 0.26858842; Z-score: 0.813168773
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Epilepsy [ICD-11: 8A60]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Peritumoral cortex
The Specific Disease Epilepsy
The Expression Level of Disease Section Compare with the Other Disease Section p-value: 0.828816916; Fold-change: -0.027381195; Z-score: -0.113643395
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Cerebral ischaemic stroke [ICD-11: 8B11]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Whole blood
The Specific Disease Cardioembolic Stroke
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.692195663; Fold-change: -0.047330282; Z-score: -0.216158299
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
The Studied Tissue Peripheral blood
The Specific Disease Ischemic stroke
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.013732072; Fold-change: 2.612903057; Z-score: 1.424708249
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 1
Click to Show/Hide the 6 Disease of This Class
HIV [ICD-11: 1C60-1C62]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue White matter
The Specific Disease HIV
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.161792773; Fold-change: -0.055508125; Z-score: -0.161287245
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Influenza [ICD-11: 1E30]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Whole blood
The Specific Disease Influenza
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.000380924; Fold-change: 1.616933607; Z-score: 6.029099829
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Chronic hepatitis C [ICD-11: 1E51.1]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Whole blood
The Specific Disease Chronic hepatitis C
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.235579687; Fold-change: 0.199038676; Z-score: 0.233965457
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Sepsis [ICD-11: 1G40-1G41]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Whole blood
The Specific Disease Sepsis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 1.82E-05; Fold-change: 0.160827897; Z-score: 0.420579343
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Septic shock [ICD-11: 1G41]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Whole blood
The Specific Disease Septic shock
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 2.39E-24; Fold-change: 0.247019643; Z-score: 0.734298063
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Pediatric respiratory syncytial virus infection [ICD-11: CA40.11]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Peripheral blood
The Specific Disease Pediatric respiratory syncytial virus infection
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.171679588; Fold-change: 0.358740811; Z-score: 0.792282241
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 11
Click to Show/Hide the 6 Disease of This Class
Essential hypertension [ICD-11: BA00]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Peripheral blood
The Specific Disease Essential hypertension
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.41950696; Fold-change: -0.145125647; Z-score: -2.12080896
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Myocardial infarction [ICD-11: BA41]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Peripheral blood
The Specific Disease Myocardial infarction
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.001209338; Fold-change: 0.339569374; Z-score: 0.357465603
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Coronary artery disease [ICD-11: BA8Z]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Peripheral blood
The Specific Disease Coronary artery disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.613545096; Fold-change: 0.231749004; Z-score: 0.565774605
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Aortic stenosis [ICD-11: BB70]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Calcified aortic valve
The Specific Disease Aortic stenosis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.134568524; Fold-change: 0.004641557; Z-score: 0.017402723
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Arteriosclerosis [ICD-11: BD40]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Peripheral blood
The Specific Disease Arteriosclerosis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.40172396; Fold-change: -0.019784309; Z-score: -0.115206238
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Aneurysm [ICD-11: BD50]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Intracranial artery
The Specific Disease Aneurysm
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 2.54E-05; Fold-change: 1.432718244; Z-score: 3.456917998
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 12
Click to Show/Hide the 8 Disease of This Class
Immunodeficiency [ICD-11: 4A00-4A20]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Peripheral blood
The Specific Disease Immunodeficiency
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.536719201; Fold-change: 0.00570044; Z-score: 0.045076811
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Apnea [ICD-11: 7A40]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Hyperplastic tonsil
The Specific Disease Apnea
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.012039743; Fold-change: 0.283851955; Z-score: 1.527974047
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Olive pollen allergy [ICD-11: CA08.00]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Peripheral blood
The Specific Disease Olive pollen allergy
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.030025556; Fold-change: -1.047631431; Z-score: -1.761683299
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Chronic rhinosinusitis [ICD-11: CA0A]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Sinus mucosa
The Specific Disease Chronic rhinosinusitis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.578817296; Fold-change: 0.04407224; Z-score: 0.329365343
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Chronic obstructive pulmonary disease [ICD-11: CA22]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Lung
The Specific Disease Chronic obstructive pulmonary disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.172422353; Fold-change: 0.127670774; Z-score: 0.40415083
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
The Studied Tissue Small airway epithelium
The Specific Disease Chronic obstructive pulmonary disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.171665611; Fold-change: 0.057338701; Z-score: 0.175417806
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Asthma [ICD-11: CA23]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Nasal and bronchial airway
The Specific Disease Asthma
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.012118064; Fold-change: 0.075042517; Z-score: 0.142465385
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Human rhinovirus infection [ICD-11: CA42]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Nasal Epithelium
The Specific Disease Human rhinovirus infection
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.039153259; Fold-change: 0.064759703; Z-score: 0.356460518
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Idiopathic pulmonary fibrosis [ICD-11: CB03.4]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Lung
The Specific Disease Idiopathic pulmonary fibrosis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.86439808; Fold-change: -0.055106752; Z-score: -0.159162326
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 13
Click to Show/Hide the 5 Disease of This Class
Periodontal disease [ICD-11: DA0C]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Gingival
The Specific Disease Periodontal disease
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.016900342; Fold-change: 0.099462109; Z-score: 0.356775566
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Eosinophilic gastritis [ICD-11: DA42.2]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Gastric antrum
The Specific Disease Eosinophilic gastritis
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.771417255; Fold-change: -0.018268879; Z-score: -0.12347993
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Liver failure [ICD-11: DB99.7-DB99.8]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Liver
The Specific Disease Liver failure
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.322752541; Fold-change: -0.061302954; Z-score: -0.247857381
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Ulcerative colitis [ICD-11: DD71]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Colon mucosal
The Specific Disease Ulcerative colitis
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.079050122; Fold-change: 0.145791558; Z-score: 0.69781347
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Irritable bowel syndrome [ICD-11: DD91.0]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Rectal colon
The Specific Disease Irritable bowel syndrome
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.120280573; Fold-change: 0.120392858; Z-score: 0.243809122
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 14
Click to Show/Hide the 5 Disease of This Class
Atopic dermatitis [ICD-11: EA80]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Skin
The Specific Disease Atopic dermatitis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 1.34E-05; Fold-change: 0.311605605; Z-score: 1.998211704
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Psoriasis [ICD-11: EA90]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Skin
The Specific Disease Psoriasis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 1.24E-17; Fold-change: 0.419760129; Z-score: 1.183735108
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.194849088; Fold-change: -0.195444781; Z-score: -0.387260543
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Vitiligo [ICD-11: ED63.0]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Skin
The Specific Disease Vitiligo
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.00727397; Fold-change: 0.330217246; Z-score: 1.286261832
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Alopecia [ICD-11: ED70]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Skin from scalp
The Specific Disease Alopecia
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 3.14E-05; Fold-change: 0.478527635; Z-score: 0.879445666
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Sensitive skin [ICD-11: EK0Z]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Skin
The Specific Disease Sensitive skin
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.71356841; Fold-change: 0.084741045; Z-score: 0.229491156
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 15
Click to Show/Hide the 6 Disease of This Class
Osteoarthritis [ICD-11: FA00-FA0Z]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Synovial
The Specific Disease Osteoarthritis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.493273716; Fold-change: 0.024317374; Z-score: 0.086415161
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Arthropathy [ICD-11: FA00-FA5Z]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Peripheral blood
The Specific Disease Arthropathy
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.371598173; Fold-change: -0.081340319; Z-score: -0.333159533
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Arthritis [ICD-11: FA20]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Peripheral blood
The Specific Disease Arthritis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.628217594; Fold-change: -0.192908009; Z-score: -0.493154757
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Rheumatoid arthritis [ICD-11: FA20]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Synovial
The Specific Disease Rheumatoid arthritis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.737571172; Fold-change: -0.074136388; Z-score: -0.155214612
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Ankylosing spondylitis [ICD-11: FA92.0Z]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Pheripheral blood
The Specific Disease Ankylosing spondylitis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.697442032; Fold-change: -0.151099456; Z-score: -0.395783002
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Osteoporosis [ICD-11: FB83]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Bone marrow
The Specific Disease Osteoporosis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.214341067; Fold-change: 0.085145745; Z-score: 0.874660799
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 16
Click to Show/Hide the 2 Disease of This Class
Endometriosis [ICD-11: GA10]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Endometrium
The Specific Disease Endometriosis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.798524401; Fold-change: 0.079632476; Z-score: 0.200925358
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Interstitial cystitis [ICD-11: GC00.3]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Bladder
The Specific Disease Interstitial cystitis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 3.57E-05; Fold-change: 1.057527414; Z-score: 5.609219886
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 19
Click to Show/Hide the 1 Disease of This Class
Preterm birth [ICD-11: KA21.4Z]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Myometrium
The Specific Disease Preterm birth
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.626358256; Fold-change: -0.066604281; Z-score: -0.352169847
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 2
Click to Show/Hide the 8 Disease of This Class
Acute myelocytic leukemia [ICD-11: 2A60]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Bone marrow
The Specific Disease Acute myelocytic leukemia
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.304434207; Fold-change: 0.114447146; Z-score: 0.109556545
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Myeloma [ICD-11: 2A83]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Bone marrow
The Specific Disease Myeloma
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.166334521; Fold-change: -0.140229567; Z-score: -0.646975638
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
The Studied Tissue Peripheral blood
The Specific Disease Myeloma
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.769685451; Fold-change: 0.279815469; Z-score: 0.184367466
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Oral cancer [ICD-11: 2B6E]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Oral
The Specific Disease Oral cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.109646061; Fold-change: -0.004452398; Z-score: -0.012017893
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 8.00E-07; Fold-change: 0.274530081; Z-score: 0.626461649
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Esophagal cancer [ICD-11: 2B70]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Esophagus
The Specific Disease Esophagal cancer
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.279552637; Fold-change: -0.210955306; Z-score: -0.38514481
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Rectal cancer [ICD-11: 2B92]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Rectal colon
The Specific Disease Rectal cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.028076561; Fold-change: 0.269502274; Z-score: 1.243180267
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.33688187; Fold-change: 0.077960489; Z-score: 0.195624051
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Skin cancer [ICD-11: 2C30-2C3Z]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Skin
The Specific Disease Skin cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.010575505; Fold-change: 0.086190732; Z-score: 0.192054425
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.000569382; Fold-change: -0.243836254; Z-score: -0.482491237
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Renal cancer [ICD-11: 2C90-2C91]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Kidney
The Specific Disease Renal cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.814390904; Fold-change: -0.134704328; Z-score: -0.303195569
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 5.73E-15; Fold-change: -0.709841118; Z-score: -1.767443659
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Ureter cancer [ICD-11: 2C92]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Urothelium
The Specific Disease Ureter cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.337716605; Fold-change: -0.084136014; Z-score: -0.538046299
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 20
Click to Show/Hide the 2 Disease of This Class
Simpson golabi behmel syndrome [ICD-11: LD2C]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Adipose
The Specific Disease Simpson golabi behmel syndrome
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.233584746; Fold-change: 0.131054062; Z-score: 0.892035521
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Tuberous sclerosis complex [ICD-11: LD2D.2]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Perituberal
The Specific Disease Tuberous sclerosis complex
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.050488736; Fold-change: 0.471204108; Z-score: 6.992460024
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 3
Click to Show/Hide the 3 Disease of This Class
Anemia [ICD-11: 3A00-3A9Z]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Bone marrow
The Specific Disease Anemia
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.870378986; Fold-change: -0.185513813; Z-score: -0.181656124
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Sickle cell disease [ICD-11: 3A51.0-3A51.3]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Peripheral blood
The Specific Disease Sickle cell disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.414548872; Fold-change: -0.115326288; Z-score: -1.134554963
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Thrombocythemia [ICD-11: 3B63]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Whole blood
The Specific Disease Thrombocythemia
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.390943814; Fold-change: -0.002738163; Z-score: -0.014061443
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 4
Click to Show/Hide the 4 Disease of This Class
Scleroderma [ICD-11: 4A42.Z]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Whole blood
The Specific Disease Scleroderma
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 9.32E-05; Fold-change: 0.321721118; Z-score: 1.933453028
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Sjogren syndrome [ICD-11: 4A43]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Salivary gland
The Specific Disease Sjogren syndrome
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.036331763; Fold-change: 0.127227665; Z-score: 1.035143496
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.839484879; Fold-change: -0.036780888; Z-score: -0.132612418
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Behcet disease [ICD-11: 4A62]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Peripheral blood
The Specific Disease Behcet disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.397490094; Fold-change: -0.00530742; Z-score: -0.002542468
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Autosomal dominant monocytopenia [ICD-11: 4B04]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Whole blood
The Specific Disease Autosomal dominant monocytopenia
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.143294442; Fold-change: 0.324021578; Z-score: 0.628366458
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 5
Click to Show/Hide the 5 Disease of This Class
Type 2 diabetes [ICD-11: 5A11]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Liver
The Specific Disease Type 2 diabetes
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.985855327; Fold-change: -0.04773752; Z-score: -0.227978829
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Polycystic ovary syndrome [ICD-11: 5A80.1]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Vastus lateralis muscle
The Specific Disease Polycystic ovary syndrome
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.516559062; Fold-change: 0.08801338; Z-score: 1.02660381
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Obesity [ICD-11: 5B81]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Subcutaneous Adipose
The Specific Disease Obesity
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.375275513; Fold-change: 0.027234351; Z-score: 0.126291961
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Pompe disease [ICD-11: 5C51.3]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Biceps muscle
The Specific Disease Pompe disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.536854944; Fold-change: 0.028003288; Z-score: 0.078739417
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Batten disease [ICD-11: 5C56.1]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Whole blood
The Specific Disease Batten disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.297107134; Fold-change: 0.164538722; Z-score: 0.373904003
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 6
Click to Show/Hide the 2 Disease of This Class
Autism [ICD-11: 6A02]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Whole blood
The Specific Disease Autism
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.828972719; Fold-change: -0.035494177; Z-score: -0.113592514
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Anxiety disorder [ICD-11: 6B00-6B0Z]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Whole blood
The Specific Disease Anxiety disorder
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.144220757; Fold-change: 0.175343964; Z-score: 0.554814277
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 8
Click to Show/Hide the 7 Disease of This Class
Parkinson disease [ICD-11: 8A00]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Substantia nigra
The Specific Disease Parkinson disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.496309707; Fold-change: 0.017211378; Z-score: 0.132533662
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Huntington disease [ICD-11: 8A01]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Whole blood
The Specific Disease Huntington disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.061004888; Fold-change: 0.293274389; Z-score: 0.963304295
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Alzheimer disease [ICD-11: 8A20]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Entorhinal cortex
The Specific Disease Alzheimer disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.873751912; Fold-change: 0.014436078; Z-score: 0.084585465
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Seizure [ICD-11: 8A60-8A6Z]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Whole blood
The Specific Disease Seizure
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.188990295; Fold-change: -0.089439592; Z-score: -0.238914005
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Lateral sclerosis [ICD-11: 8B60.4]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Skin
The Specific Disease Lateral sclerosis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.264001064; Fold-change: 0.12222219; Z-score: 0.734832414
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
The Studied Tissue Cervical spinal cord
The Specific Disease Lateral sclerosis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.851328013; Fold-change: 0.051401357; Z-score: 0.27264405
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Muscular atrophy [ICD-11: 8C70]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Muscle
The Specific Disease Muscular atrophy
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.61890363; Fold-change: 0.024178289; Z-score: 0.108658506
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Myopathy [ICD-11: 8C70.6]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Muscle
The Specific Disease Myopathy
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.030661265; Fold-change: 0.056025193; Z-score: 0.324426796
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
References
Ref 1 Study to Evaluate Adverse Events and Change in Disease Activity in Participants Between 18 to 75 Years of Age Treated With Subcutaneous (SC) Injections of ABBV-154 for Moderately to Severely Active Rheumatoid Arthritis (RA); NCT04888585,
Ref 2 Introduction to basic information on ADC drug adalimumab fosimdesonide.
Ref 3 Zyngenia biotherapeutics company program bi-specific anti-TNFalpha/Ang2 Zybodies.
Ref 4 Covalent linkers in antibody-drug conjugates and methods of making and using the same.
Ref 5 Steroid conjugate; 2022-06-30.
Ref 6 Steroid conjugate; 2022-08-18.
Ref 7 Steroid compound and conjugate thereof; 2023-03-02.