Antigen Information
General Information of This Antigen (ID: TAR0MSWGX)
| Antigen Name | Tumor necrosis factor (TNF) |
|||||
|---|---|---|---|---|---|---|
| Gene Name | TNF |
|||||
| Gene ID | ||||||
| Synonym | TNFA; TNFSF2; Cachectin;TNF-alpha;Tumor necrosis factor ligand superfamily member 2 |
|||||
| Sequence |
MSTESMIRDVELAEEALPKKTGGPQGSRRCLFLSLFSFLIVAGATTLFCLLHFGVIGPQR
EEFPRDLSLISPLAQAVRSSSRTPSDKPVAHVVANPQAEGQLQWLNRRANALLANGVELR DNQLVVPSEGLYLIYSQVLFKGQGCPSTHVLLTHTISRIAVSYQTKVNLLSAIKSPCQRE TPEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINRPDYLDFAESGQVYFGIIAL Click to Show/Hide
|
|||||
| Family | Tumor necrosis factor family |
|||||
| Function |
Cytokine that binds to TNFRSF1A/TNFR1 and TNFRSF1B/TNFBR. It is mainly secreted by macrophages and can induce cell death of certain tumor cell lines. It is potent pyrogen causing fever by direct action or by stimulation of interleukin-1 secretion and is implicated in the induction of cachexia, Under certain conditions it can stimulate cell proliferation and induce cell differentiation. Impairs regulatory T- cells (Treg) function in individuals with rheumatoid arthritis via FOXP3 dephosphorylation. Up-regulates the expression of protein phosphatase 1 (PP1), which dephosphorylates the key 'Ser-418' residue of FOXP3, thereby inactivating FOXP3 and rendering Treg cells functionally defective. Key mediator of cell death in the anticancer action of BCG-stimulated neutrophils in combination with DIABLO/SMAC mimetic in the RT4v6 bladder cancer cell line. Induces insulin resistance in adipocytes via inhibition of insulin-induced IRS1 tyrosine phosphorylation and insulin-induced glucose uptake. Induces GKAP42 protein degradation in adipocytes which is partially responsible for TNF-induced insulin resistance. Plays a role in angiogenesis by inducing VEGF production synergistically with IL1B and IL6.
Click to Show/Hide
|
|||||
| Uniprot Entry | ||||||
| HGNC ID | ||||||
| KEGG ID | ||||||
Each Antibody-drug Conjugate and Its Component Related to This Antigen
Full List of The ADC Related to This Antigen
| The Numbers of ADCs, Their Three Components, Payload Targets, and Corresponding Diseases for This Antigens | ||||
|---|---|---|---|---|
Adalimumab
| ADC Name | Payload | Target | Linker | ADC Info |
|---|---|---|---|---|
|
ABBV-3373
|
Glucocorticoid receptor modulator |
Glucocorticoid receptor (NR3C1) |
MP-Ala-Ala |
|
|
ABBV-154
|
Glucocorticoid receptor modulator |
Glucocorticoid receptor (NR3C1) |
Formyl-Gly-Glu |
|
|
Adalimumab/anti-Ang2 Zybody
[1]
|
Angiopep-2 TFA |
Undisclosed |
Undisclosed |
|
|
Adalimumab fosimdesonide
[2]
|
SGD-1882 |
Human Deoxyribonucleic acid (hDNA) |
Undisclosed |
|
|
WO2022171101A1 ADC-45
[3]
|
WO2022171101A1 ADC-45 payload |
Undisclosed |
WO2022171101A1 ADC-45 linker |
|
|
WO2022171101A1 ADC-48
[3]
|
WO2022171101A1 ADC-48 payload |
Undisclosed |
WO2022171101A1 ADC-48 linker |
|
|
WO2023025248A1 ADC-56
[4]
|
WO2023025248A1 ADC-56 payload |
Undisclosed |
WO2023025248A1 ADC-56 linker |
|
|
WO2022135332A1 1-9
[5]
|
WO2022135332A1_1-9 payload |
Undisclosed |
WO2022135332A1_1-9 linker |
|
|
WO2022135332A1 1-10
[5]
|
WO2022135332A1_1-10 payload |
Undisclosed |
WO2022135332A1_1-10 linker |
|
|
WO2022135332A1 1-11
[5]
|
WO2022135332A1_1-11 payload |
Undisclosed |
WO2022135332A1_1-11 linker |
|
|
WO2022135332A1 1-13
[5]
|
WO2022135332A1_1-13 payload |
Undisclosed |
WO2022135332A1_1-13 linker |
|
|
Adalimumab-Compound 9
[6]
|
Mertansine DM1 |
Microtubule (MT) |
Adalimumab-Compound 9 linker |
|
|
Adalimumab-Compound 17
[6]
|
Mertansine DM4 |
Microtubule (MT) |
Adalimumab-Compound 17 linker |
|
|
Adalimumab-Compound 25
[6]
|
Monomethyl auristatin E |
Microtubule (MT) |
Adalimumab-Compound 25 linker |
|
|
Adalimumab-Compound 31
[6]
|
Auristatin 0101 |
Microtubule (MT) |
Adalimumab-Compound 31 linker |
|
|
Adalimumab-Compound 36
[6]
|
Monomethyl auristatin E |
Microtubule (MT) |
Adalimumab-Compound 36 linker |
|
|
Adalimumab-Compound 43
[6]
|
PBD dimer |
Human Deoxyribonucleic acid (hDNA) |
Adalimumab-Compound 43 linker |
|
|
Adalimumab-Compound 49
[6]
|
PBD dimer |
Human Deoxyribonucleic acid (hDNA) |
Adalimumab-Compound 49 linker |
|
|
Adalimumab-Compound 55
[6]
|
Mertansine DM1 |
Microtubule (MT) |
Adalimumab-Compound 55 linker |
|
|
Adalimumab-Compound 59
[6]
|
Mertansine DM4 |
Microtubule (MT) |
Adalimumab-Compound 59 linker |
|
|
Adalimumab-Compound 64
[6]
|
Monomethyl auristatin E |
Microtubule (MT) |
Adalimumab-Compound 64 linker |
|
|
Adalimumab-Compound 69
[6]
|
Monomethyl auristatin E |
Microtubule (MT) |
Adalimumab-Compound 69 linker |
|
|
Adalimumab-Compound 74
[6]
|
PBD dimer |
Human Deoxyribonucleic acid (hDNA) |
Adalimumab-Compound 74 linker |
|
|
Adalimumab-Compound 75
[6]
|
Monomethyl auristatin E |
Microtubule (MT) |
Adalimumab-Compound 75 linker |
|
|
Adalimumab-Compound 76
[6]
|
Monomethyl auristatin E |
Microtubule (MT) |
Adalimumab-Compound 76 linker |
|
|
Adalimumab-Compound 77
[6]
|
Mertansine DM1 |
Microtubule (MT) |
Adalimumab-Compound 77 linker |
|
|
Adalimumab-Compound 78
[6]
|
Auristatin 0101 |
Microtubule (MT) |
Adalimumab-Compound 78 linker |
|
|
Adalimumab-Compound 79
[6]
|
Auristatin 0101 |
Microtubule (MT) |
Adalimumab-Compound 79 linker |
|
|
Adalimumab-Compound 80
[6]
|
Mertansine DM4 |
Microtubule (MT) |
Adalimumab-Compound 80 linker |
|
|
Anti-TNFalpha_VCGP-Dex
[7]
|
Dexamethasone |
Glucocorticoid receptor (NR3C1) |
Mal-ValCitGlyPro-OH |
Golimumab
| ADC Name | Payload | Target | Linker | ADC Info |
|---|---|---|---|---|
|
Golimumab-Compound 9
[6]
|
Mertansine DM1 |
Microtubule (MT) |
Golimumab-Compound 9 linker |
|
|
Golimumab-Compound 17
[6]
|
Mertansine DM4 |
Microtubule (MT) |
Golimumab-Compound 17 linker |
|
|
Golimumab-Compound 25
[6]
|
Monomethyl auristatin E |
Microtubule (MT) |
Golimumab-Compound 25 linker |
|
|
Golimumab-Compound 31
[6]
|
Auristatin 0101 |
Microtubule (MT) |
Golimumab-Compound 31 linker |
|
|
Golimumab-Compound 36
[6]
|
Monomethyl auristatin E |
Microtubule (MT) |
Golimumab-Compound 36 linker |
|
|
Golimumab-Compound 43
[6]
|
PBD dimer |
Human Deoxyribonucleic acid (hDNA) |
Golimumab-Compound 43 linker |
|
|
Golimumab-Compound 49
[6]
|
PBD dimer |
Human Deoxyribonucleic acid (hDNA) |
Golimumab-Compound 49 linker |
|
|
Golimumab-Compound 55
[6]
|
Mertansine DM1 |
Microtubule (MT) |
Golimumab-Compound 55 linker |
|
|
Golimumab-Compound 59
[6]
|
Mertansine DM4 |
Microtubule (MT) |
Golimumab-Compound 59 linker |
|
|
Golimumab-Compound 64
[6]
|
Monomethyl auristatin E |
Microtubule (MT) |
Golimumab-Compound 64 linker |
|
|
Golimumab-Compound 69
[6]
|
Monomethyl auristatin E |
Microtubule (MT) |
Golimumab-Compound 69 linker |
|
|
Golimumab-Compound 74
[6]
|
PBD dimer |
Human Deoxyribonucleic acid (hDNA) |
Golimumab-Compound 74 linker |
|
|
Golimumab-Compound 75
[6]
|
Monomethyl auristatin E |
Microtubule (MT) |
Golimumab-Compound 75 linker |
|
|
Golimumab-Compound 76
[6]
|
Monomethyl auristatin E |
Microtubule (MT) |
Golimumab-Compound 76 linker |
|
|
Golimumab-Compound 77
[6]
|
Mertansine DM1 |
Microtubule (MT) |
Golimumab-Compound 77 linker |
|
|
Golimumab-Compound 78
[6]
|
Auristatin 0101 |
Microtubule (MT) |
Golimumab-Compound 78 linker |
|
|
Golimumab-Compound 79
[6]
|
Auristatin 0101 |
Microtubule (MT) |
Golimumab-Compound 79 linker |
|
|
Golimumab-Compound 80
[6]
|
Mertansine DM4 |
Microtubule (MT) |
Golimumab-Compound 80 linker |
hu a-TNF
| ADC Name | Payload | Target | Linker | ADC Info |
|---|---|---|---|---|
|
38780432 ADC 8
[8]
|
Cpd 6 |
Undisclosed |
BrAc-Ala-Ala |
Human anti-TNF
| ADC Name | Payload | Target | Linker | ADC Info |
|---|---|---|---|---|
|
37379257 ADC 5
[9]
|
Undisclosed |
Undisclosed |
MP-Ala-Ala |
|
|
37379257 ADC 6
[9]
|
Undisclosed |
Undisclosed |
M-Gly-Ala-Ala |
|
|
37379257 ADC 17
[9]
|
Undisclosed |
Undisclosed |
M-Gly-Ala-Ala |
|
|
37379257 ADC 18
[9]
|
Undisclosed |
Undisclosed |
M-Gly-Ala |
|
|
37379257 ADC 19
[9]
|
Undisclosed |
Undisclosed |
M-Gly-GluF |
Infliximab
| ADC Name | Payload | Target | Linker | ADC Info |
|---|---|---|---|---|
|
Infliximab-Compound 9
[6]
|
Mertansine DM1 |
Microtubule (MT) |
Infliximab-Compound 9 linker |
|
|
Infliximab-Compound 17
[6]
|
Mertansine DM4 |
Microtubule (MT) |
Infliximab-Compound 17 linker |
|
|
Infliximab-Compound 25
[6]
|
Monomethyl auristatin E |
Microtubule (MT) |
Infliximab-Compound 25 linker |
|
|
Infliximab-Compound 31
[6]
|
Auristatin 0101 |
Microtubule (MT) |
Infliximab-Compound 31 linker |
|
|
Infliximab-Compound 36
[6]
|
Monomethyl auristatin E |
Microtubule (MT) |
Infliximab-Compound 36 linker |
|
|
Infliximab-Compound 43
[6]
|
PBD dimer |
Human Deoxyribonucleic acid (hDNA) |
Infliximab-Compound 43 linker |
|
|
Infliximab-Compound 49
[6]
|
PBD dimer |
Human Deoxyribonucleic acid (hDNA) |
Infliximab-Compound 49 linker |
|
|
Infliximab-Compound 55
[6]
|
Mertansine DM1 |
Microtubule (MT) |
Infliximab-Compound 55 linker |
|
|
Infliximab-Compound 59
[6]
|
Mertansine DM4 |
Microtubule (MT) |
Infliximab-Compound 59 linker |
|
|
Infliximab-Compound 64
[6]
|
Monomethyl auristatin E |
Microtubule (MT) |
Infliximab-Compound 64 linker |
|
|
Infliximab-Compound 69
[6]
|
Monomethyl auristatin E |
Microtubule (MT) |
Infliximab-Compound 69 linker |
|
|
Infliximab-Compound 74
[6]
|
PBD dimer |
Human Deoxyribonucleic acid (hDNA) |
Infliximab-Compound 74 linker |
|
|
Infliximab-Compound 75
[6]
|
Monomethyl auristatin E |
Microtubule (MT) |
Infliximab-Compound 75 linker |
|
|
Infliximab-Compound 76
[6]
|
Monomethyl auristatin E |
Microtubule (MT) |
Infliximab-Compound 76 linker |
|
|
Infliximab-Compound 77
[6]
|
Mertansine DM1 |
Microtubule (MT) |
Infliximab-Compound 77 linker |
|
|
Infliximab-Compound 78
[6]
|
Auristatin 0101 |
Microtubule (MT) |
Infliximab-Compound 78 linker |
|
|
Infliximab-Compound 79
[6]
|
Auristatin 0101 |
Microtubule (MT) |
Infliximab-Compound 79 linker |
|
|
Infliximab-Compound 80
[6]
|
Mertansine DM4 |
Microtubule (MT) |
Infliximab-Compound 80 linker |
mAb-C
| ADC Name | Payload | Target | Linker | ADC Info |
|---|---|---|---|---|
|
WO2024140927A1-ADC-C (DAR2)
[10]
|
Monomethyl auristatin E |
Microtubule (MT) |
Mc-Val-Cit-PABC |
|
|
WO2024140927A1-ADC-C (DAR4)
[10]
|
Monomethyl auristatin E |
Microtubule (MT) |
Mc-Val-Cit-PABC |
|
|
WO2024140927A1-ADC-C (DAR7)
[10]
|
Monomethyl auristatin E |
Microtubule (MT) |
Mc-Val-Cit-PABC |
Mouse anti-TNF
| ADC Name | Payload | Target | Linker | ADC Info |
|---|---|---|---|---|
|
37379257 ADC 3
[9]
|
Undisclosed |
Undisclosed |
MP-Ala-Ala |
|
|
37379257 ADC 4
[9]
|
Undisclosed |
Undisclosed |
M-Gly-Ala-Ala |
|
|
37379257 ADC 14
[9]
|
Undisclosed |
Undisclosed |
M-Gly-Ala-Ala |
|
|
37379257 ADC 15
[9]
|
Undisclosed |
Undisclosed |
M-Gly-Ala |
|
|
37379257 ADC 16
[9]
|
Undisclosed |
Undisclosed |
M-Gly-GluF |
mu a-TNF
| ADC Name | Payload | Target | Linker | ADC Info |
|---|---|---|---|---|
|
38780432 ADC 1
[8]
|
Cpd 2 |
Undisclosed |
MP-Ala-Ala |
|
|
38780432 ADC 2
[8]
|
Cpd 6 |
Undisclosed |
M-Gly-GluF |
|
|
38780432 ADC 3
[8]
|
Cpd 4 |
Undisclosed |
M-Gly-GluF |
|
|
38780432 ADC 4
[8]
|
Cpd 6 |
Undisclosed |
M-Gly-Ala-Ala |
|
|
38780432 ADC 5
[8]
|
Cpd 6 |
Undisclosed |
BrAc-Ala-Ala |
|
|
38780432 ADC 6
[8]
|
Cpd 6 |
Undisclosed |
BrAc-Gly-Glu |
|
|
38780432 ADC 7
[8]
|
Cpd 6 |
Undisclosed |
BrAc-Ala-Glu |
Undisclosed
| ADC Name | Payload | Target | Linker | ADC Info |
|---|---|---|---|---|
|
38283215 ADC 1
[11]
|
GRM payload C1 |
Undisclosed |
Ala-Ala linker |
|
|
38283215 ADC 2
[11]
|
GRM payload C1 |
Undisclosed |
Ala-Arg linker |
|
|
38283215 ADC 3
[11]
|
GRM payload C1 |
Undisclosed |
Ala-Gln linker |
|
|
38283215 ADC 4
[11]
|
GRM payload C1 |
Undisclosed |
Ala-Glu linker |
|
|
38283215 ADC 5
[11]
|
GRM payload C1 |
Undisclosed |
Ala-Gly linker |
|
|
38283215 ADC 6
[11]
|
GRM payload C1 |
Undisclosed |
Ala-His linker |
|
|
38283215 ADC 7
[11]
|
GRM payload C1 |
Undisclosed |
Ala-Lys linker |
|
|
38283215 ADC 8
[11]
|
GRM payload C1 |
Undisclosed |
Ala-Ser linker |
|
|
38283215 ADC 9
[11]
|
GRM payload C1 |
Undisclosed |
Gly-Ala linker |
|
|
38283215 ADC 10
[11]
|
GRM payload C1 |
Undisclosed |
Gly-Gln linker |
|
|
38283215 ADC 11
[11]
|
GRM payload C1 |
Undisclosed |
Gly-Glu linker |
|
|
38283215 ADC 12
[11]
|
GRM payload C1 |
Undisclosed |
Gly-Gly linker |
|
|
38283215 ADC 13
[11]
|
GRM payload C1 |
Undisclosed |
Gly-Ser linker |
|
|
38283215 ADC 14
[11]
|
GRM payload C1 |
Undisclosed |
Phe-Lys linker |
|
|
38283215 ADC 15
[11]
|
GRM payload C1 |
Undisclosed |
Ser-Ala linker |
|
|
38283215 ADC 16
[11]
|
GRM payload C1 |
Undisclosed |
Ser-Asn linker |
|
|
38283215 ADC 17
[11]
|
GRM payload C1 |
Undisclosed |
Ser-Gln linker |
|
|
38283215 ADC 18
[11]
|
GRM payload C1 |
Undisclosed |
Ser-Glu linker |
|
|
38283215 ADC 19
[11]
|
GRM payload C1 |
Undisclosed |
Ser-Gly linker |
|
|
38283215 ADC 20
[11]
|
GRM payload C1 |
Undisclosed |
Val-Ala linker |
|
|
38283215 ADC 21
[11]
|
GRM payload C1 |
Undisclosed |
Val-Arg linker |
|
|
38283215 ADC 22
[11]
|
GRM payload C1 |
Undisclosed |
Val-Cit linker |
|
|
38283215 ADC 23
[11]
|
GRM payload C1 |
Undisclosed |
Val-Asn linker |
|
|
38283215 ADC 24
[11]
|
GRM payload C1 |
Undisclosed |
Val-Gln linker |
|
|
38283215 ADC 25
[11]
|
GRM payload C1 |
Undisclosed |
Val-Glu linker |
|
|
38283215 ADC 26
[11]
|
GRM payload C1 |
Undisclosed |
Val-Gly linker |
|
|
38283215 ADC 27
[11]
|
GRM payload C1 |
Undisclosed |
Val-Ser linker |
|
|
38283215 ADC 28
[11]
|
GRM payload C1 |
Undisclosed |
Ala-Ala linker |
|
|
38283215 ADC 29
[11]
|
GRM payload C1 |
Undisclosed |
Ala-Arg linker |
|
|
38283215 ADC 30
[11]
|
GRM payload C1 |
Undisclosed |
Ala-Gln linker |
|
|
38283215 ADC 31
[11]
|
GRM payload C1 |
Undisclosed |
Ala-Glu linker |
|
|
38283215 ADC 32
[11]
|
GRM payload C1 |
Undisclosed |
Ala-Gly linker |
|
|
38283215 ADC 33
[11]
|
GRM payload C1 |
Undisclosed |
Ala-His linker |
|
|
38283215 ADC 34
[11]
|
GRM payload C1 |
Undisclosed |
Ala-Ser linker |
|
|
38283215 ADC 35
[11]
|
GRM payload C1 |
Undisclosed |
Ala-Asn linker |
|
|
38283215 ADC 36
[11]
|
GRM payload C1 |
Undisclosed |
Ala-Val linker |
|
|
38283215 ADC 37
[11]
|
GRM payload C1 |
Undisclosed |
Ala-Phe linker |
|
|
38283215 ADC 38
[11]
|
GRM payload C1 |
Undisclosed |
Gly-Ala linker |
|
|
38283215 ADC 39
[11]
|
GRM payload C1 |
Undisclosed |
Gly-Gln linker |
|
|
38283215 ADC 40
[11]
|
GRM payload C1 |
Undisclosed |
Gly-Glu linker |
|
|
38283215 ADC 41
[11]
|
GRM payload C1 |
Undisclosed |
Gly-Gly linker |
|
|
38283215 ADC 42
[11]
|
GRM payload C1 |
Undisclosed |
Gly-Ser linker |
|
|
38283215 ADC 43
[11]
|
GRM payload C1 |
Undisclosed |
Phe-Lys linker |
|
|
38283215 ADC 44
[11]
|
GRM payload C1 |
Undisclosed |
Ser-Ala linker |
|
|
38283215 ADC 45
[11]
|
GRM payload C1 |
Undisclosed |
Ser-Asn linker |
|
|
38283215 ADC 46
[11]
|
GRM payload C1 |
Undisclosed |
Ser-Gln linker |
|
|
38283215 ADC 47
[11]
|
GRM payload C1 |
Undisclosed |
Ser-Glu linker |
|
|
38283215 ADC 48
[11]
|
GRM payload C1 |
Undisclosed |
Ser-Gly linker |
|
|
38283215 ADC 49
[11]
|
GRM payload C1 |
Undisclosed |
Val-Ala linker |
|
|
38283215 ADC 50
[11]
|
GRM payload C1 |
Undisclosed |
Val-Arg linker |
|
|
38283215 ADC 51
[11]
|
GRM payload C1 |
Undisclosed |
Val-Cit linker |
|
|
38283215 ADC 52
[11]
|
GRM payload C1 |
Undisclosed |
Val-Asn linker |
|
|
38283215 ADC 53
[11]
|
GRM payload C1 |
Undisclosed |
Val-Gln linker |
|
|
38283215 ADC 54
[11]
|
GRM payload C1 |
Undisclosed |
Val-Glu linker |
|
|
38283215 ADC 55
[11]
|
GRM payload C1 |
Undisclosed |
Val-Gly linker |
|
|
38283215 ADC 56
[11]
|
GRM payload C1 |
Undisclosed |
Val-Ser linker |
References
