Antigen Information

General Information of This Antigen
Antigen ID
TAR0JDMFW
Antigen Name
Integrin beta-3 (ITGB3)
Gene Name
ITGB3
Gene ID
3690
Synonym
GP3A; Platelet membrane glycoprotein IIIa; CD_antigen=CD61
Sequence
MRARPRPRPLWATVLALGALAGVGVGGPNICTTRGVSSCQQCLAVSPMCAWCSDEALPLG
SPRCDLKENLLKDNCAPESIEFPVSEARVLEDRPLSDKGSGDSSQVTQVSPQRIALRLRP
DDSKNFSIQVRQVEDYPVDIYYLMDLSYSMKDDLWSIQNLGTKLATQMRKLTSNLRIGFG
AFVDKPVSPYMYISPPEALENPCYDMKTTCLPMFGYKHVLTLTDQVTRFNEEVKKQSVSR
NRDAPEGGFDAIMQATVCDEKIGWRNDASHLLVFTTDAKTHIALDGRLAGIVQPNDGQCH
VGSDNHYSASTTMDYPSLGLMTEKLSQKNINLIFAVTENVVNLYQNYSELIPGTTVGVLS
MDSSNVLQLIVDAYGKIRSKVELEVRDLPEELSLSFNATCLNNEVIPGLKSCMGLKIGDT
VSFSIEAKVRGCPQEKEKSFTIKPVGFKDSLIVQVTFDCDCACQAQAEPNSHRCNNGNGT
FECGVCRCGPGWLGSQCECSEEDYRPSQQDECSPREGQPVCSQRGECLCGQCVCHSSDFG
KITGKYCECDDFSCVRYKGEMCSGHGQCSCGDCLCDSDWTGYYCNCTTRTDTCMSSNGLL
CSGRGKCECGSCVCIQPGSYGDTCEKCPTCPDACTFKKECVECKKFDRGALHDENTCNRY
CRDEIESVKELKDTGKDAVNCTYKNEDDCVVRFQYYEDSSGKSILYVVEEPECPKGPDIL
VVLLSVMGAILLIGLAALLIWKLLITIHDRKEFAKFEEERARAKWDTANNPLYKEATSTF
TNITYRGT

    Click to Show/Hide
Family
Integrin beta chain family
Function
Integrin alpha-V/beta-3 (ITGAV:ITGB3) is a receptor for cytotactin, fibronectin, laminin, matrix metalloproteinase-2, osteopontin, osteomodulin, prothrombin, thrombospondin, vitronectin and von Willebrand factor. Integrin alpha-IIb/beta-3 (ITGA2B:ITGB3) is a receptor for fibronectin, fibrinogen, plasminogen, prothrombin, thrombospondin and vitronectin. Integrins alpha-IIb/beta-3 and alpha- V/beta-3 recognize the sequence R-G-D in a wide array of ligands. Integrin alpha-IIb/beta-3 recognizes the sequence H-H-L-G-G-G-A-K-Q-A- G-D-V in fibrinogen gamma chain. Following activation integrin alpha- IIb/beta-3 brings about platelet/platelet interaction through binding of soluble fibrinogen. This step leads to rapid platelet aggregation which physically plugs ruptured endothelial surface. Fibrinogen binding enhances SELP expression in activated platelets. ITGAV:ITGB3 binds to fractalkine (CX3CL1) and acts as its coreceptor in CX3CR1-dependent fractalkine signaling. ITGAV:ITGB3 binds to NRG1 (via EGF domain) and this binding is essential for NRG1-ERBB signaling. ITGAV:ITGB3 binds to FGF1 and this binding is essential for FGF1 signaling. ITGAV:ITGB3 binds to FGF2 and this binding is essential for FGF2 signaling. ITGAV:ITGB3 binds to IGF1 and this binding is essential for IGF1 signaling. ITGAV:ITGB3 binds to IGF2 and this binding is essential for IGF2 signaling. ITGAV:ITGB3 binds to IL1B and this binding is essential for IL1B signaling. ITGAV:ITGB3 binds to PLA2G2A via a site (site 2) which is distinct from the classical ligand-binding site (site 1) and this induces integrin conformational changes and enhanced ligand binding to site 1. ITGAV:ITGB3 acts as a receptor for fibrillin-1 (FBN1) and mediates R-G-D-dependent cell adhesion to FBN1. In brain, plays a role in synaptic transmission and plasticity. Involved in the regulation of the serotonin neurotransmission, is required to localize to specific compartments within the synapse the serotonin receptor SLC6A4 and for an appropriate reuptake of serotonin. Controls excitatory synaptic strength by regulating GRIA2-containing AMPAR endocytosis, which affects AMPAR abundance and composition. ITGAV:ITGB3 act as a receptor for CD40LG. (Microbial infection) Integrin ITGAV:ITGB3 acts as a receptor for Herpes virus 8/HHV-8. (Microbial infection) Integrin ITGAV:ITGB3 acts as a receptor for Coxsackievirus A9. (Microbial infection) Acts as a receptor for Hantaan virus. (Microbial infection) Integrin ITGAV:ITGB3 acts as a receptor for Cytomegalovirus/HHV-5. (Microbial infection) Integrin ITGA5:ITGB3 acts as a receptor for Human metapneumovirus. (Microbial infection) Integrin ITGAV:ITGB3 acts aP05556s a receptor for Human parechovirus 1. (Microbial infection) Integrin ITGAV:ITGB3 acts as a receptor for West nile virus. (Microbial infection) In case of HIV-1 infection, the interaction with extracellular viral Tat protein seems to enhance angiogenesis in Kaposi's sarcoma lesions.

    Click to Show/Hide
Uniprot Entry
ITB3_HUMAN
HGNC ID
HGNC:6156
KEGG ID
hsa:3690
Each Antibody-drug Conjuate AND It's Component Related to This Antigen
Full List of The ADC Related to This Antigen
Anti-ITGA2B scFv
 Antibody Info 
ADC Info ADC Name Payload Target Linker Ref
 ADC Info 
ScFvGPIIb/IIIa-MMAE
Monomethyl auristatin E
Microtubule (MT)
Mc-Val-Cit-PABC
 [1]
Tissue/Disease specific Abundances of This Antigen
Tissue specific Abundances of This Antigen
ICD Disease Classification 01
Click to Show/Hide the 1 Disease of This Class
Bacterial infection [ICD-11: 1A00-1C4Z]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Gingival
The Specific Disease Bacterial infection of gingival
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.115422165; Fold-change: 0.031787224; Z-score: 0.140247155
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue
Download Antigen expression data in the tissue of healthy individual
ICD Disease Classification 02
Click to Show/Hide the 22 Disease of This Class
Brain cancer [ICD-11: 2A00]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue White matter
The Specific Disease Glioma
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.130294803; Fold-change: 0.106217773; Z-score: 0.399923577
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue
Download Antigen expression data in the tissue of healthy individual
The Studied Tissue Brainstem
The Specific Disease Glioma
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.943596306; Fold-change: -0.033975107; Z-score: -0.18864837
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue
Download Antigen expression data in the tissue of healthy individual
The Studied Tissue Brainstem
The Specific Disease Neuroectodermal tumor
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.237707806; Fold-change: -0.20163639; Z-score: -0.683585111
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue
Download Antigen expression data in the tissue of healthy individual
The Studied Tissue Nervous
The Specific Disease Brain cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 3.34E-22; Fold-change: 0.138984574; Z-score: 0.607653589
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue
Download Antigen expression data in the tissue of healthy individual
Chronic myeloid leukemia [ICD-11: 2A20]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Whole blood
The Specific Disease Myelofibrosis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.121314441; Fold-change: 0.119927695; Z-score: 0.676136108
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue
Download Antigen expression data in the tissue of healthy individual
The Studied Tissue Whole blood
The Specific Disease Polycythemia vera
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 4.61E-08; Fold-change: 0.201804523; Z-score: 1.080795616
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue
Download Antigen expression data in the tissue of healthy individual
MyeloDysplastic syndromes [ICD-11: 2A37]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Bone marrow
The Specific Disease Myelodysplastic syndromes
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.008818827; Fold-change: -0.031614128; Z-score: -0.163776875
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.697829753; Fold-change: -0.05792179; Z-score: -0.259057606
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section
Download Antigen expression data of patients in the disease section of the tissue
Download Antigen expression data in the tissue of healthy individual
Lymphoma [ICD-11: 2A90- 2A85]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Tonsil
The Specific Disease Lymphoma
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.921040041; Fold-change: -0.093540666; Z-score: -0.418301636
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue
Download Antigen expression data in the tissue of healthy individual
Gastric cancer [ICD-11: 2B72]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Gastric
The Specific Disease Gastric cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.713562176; Fold-change: -0.157353692; Z-score: -0.493602778
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.013257231; Fold-change: 0.176028933; Z-score: 0.721211362
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section
Download Antigen expression data of patients in the disease section of the tissue
Download Antigen expression data in the tissue of healthy individual
Colon cancer [ICD-11: 2B90]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Colon
The Specific Disease Colon cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.001428857; Fold-change: 0.063767431; Z-score: 0.259465434
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.745236615; Fold-change: -0.008991697; Z-score: -0.040992501
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section
Download Antigen expression data of patients in the disease section of the tissue
Download Antigen expression data in the tissue of healthy individual
Pancreatic cancer [ICD-11: 2C10]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Pancreas
The Specific Disease Pancreatic cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.079275312; Fold-change: -0.182982652; Z-score: -0.560529596
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.557653135; Fold-change: -0.100851751; Z-score: -0.466880467
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section
Download Antigen expression data of patients in the disease section of the tissue
Download Antigen expression data in the tissue of healthy individual
Liver cancer [ICD-11: 2C12]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Liver
The Specific Disease Liver cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 7.18E-05; Fold-change: -0.224121357; Z-score: -0.797069861
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.945871564; Fold-change: -0.027414848; Z-score: -0.112526037
The Expression Level of Disease Section Compare with the Other Disease Section p-value: 0.606849204; Fold-change: 0.002261602; Z-score: 0.010496154
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section
Download Antigen expression data of patients in the disease section of the tissue
Download Antigen expression data in the tissue of healthy individual
Download Antigen expression data in the tissue of the other disease section
Lung cancer [ICD-11: 2C25]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Lung
The Specific Disease Lung cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.010820329; Fold-change: 0.01729196; Z-score: 0.072046166
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.08193759; Fold-change: -0.091996271; Z-score: -0.276494772
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section
Download Antigen expression data of patients in the disease section of the tissue
Download Antigen expression data in the tissue of healthy individual
Melanoma [ICD-11: 2C30]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Skin
The Specific Disease Melanoma
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.003306749; Fold-change: 0.359103373; Z-score: 0.477718118
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue
Download Antigen expression data in the tissue of healthy individual
Sarcoma [ICD-11: 2C35]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Muscle
The Specific Disease Sarcoma
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 4.26E-30; Fold-change: 0.246504973; Z-score: 1.022079117
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.002283435; Fold-change: 0.288624837; Z-score: 2.678130944
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section
Download Antigen expression data of patients in the disease section of the tissue
Download Antigen expression data in the tissue of healthy individual
Breast cancer [ICD-11: 2C60]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Breast
The Specific Disease Breast cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 3.47E-06; Fold-change: -0.113560556; Z-score: -0.39761013
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.064859764; Fold-change: -0.085523602; Z-score: -0.267064476
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section
Download Antigen expression data of patients in the disease section of the tissue
Download Antigen expression data in the tissue of healthy individual
Ovarian cancer [ICD-11: 2C73]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Ovarian
The Specific Disease Ovarian cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.10612422; Fold-change: 0.184754288; Z-score: 0.574242652
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.071806177; Fold-change: 0.101010653; Z-score: 0.074722317
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section
Download Antigen expression data of patients in the disease section of the tissue
Download Antigen expression data in the tissue of healthy individual
Cervical cancer [ICD-11: 2C77]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Cervical
The Specific Disease Cervical cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.033694649; Fold-change: -0.060404612; Z-score: -0.283041893
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue
Download Antigen expression data in the tissue of healthy individual
Uterine cancer [ICD-11: 2C78]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Endometrium
The Specific Disease Uterine cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 1.20E-05; Fold-change: -0.189445621; Z-score: -0.463933013
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.000134666; Fold-change: -2.320862336; Z-score: -7.010614173
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section
Download Antigen expression data of patients in the disease section of the tissue
Download Antigen expression data in the tissue of healthy individual
Prostate cancer [ICD-11: 2C82]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Prostate
The Specific Disease Prostate cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.081894191; Fold-change: -0.161883445; Z-score: -0.461916409
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue
Download Antigen expression data in the tissue of healthy individual
Bladder cancer [ICD-11: 2C94]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Bladder
The Specific Disease Bladder cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.184023421; Fold-change: 0.10469598; Z-score: 0.384502537
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue
Download Antigen expression data in the tissue of healthy individual
Retina cancer [ICD-11: 2D02]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Uvea
The Specific Disease Retinoblastoma tumor
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.202580465; Fold-change: 0.107838209; Z-score: 0.776093079
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue
Download Antigen expression data in the tissue of healthy individual
Thyroid cancer [ICD-11: 2D10]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Thyroid
The Specific Disease Thyroid cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.001657968; Fold-change: -0.151746808; Z-score: -0.30615631
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.601401979; Fold-change: 0.125820341; Z-score: 0.228698252
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section
Download Antigen expression data of patients in the disease section of the tissue
Download Antigen expression data in the tissue of healthy individual
Adrenal cancer [ICD-11: 2D11]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Adrenal cortex
The Specific Disease Adrenocortical carcinoma
The Expression Level of Disease Section Compare with the Other Disease Section p-value: 0.137622277; Fold-change: 0.042481067; Z-score: 0.384622298
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue
Download Antigen expression data in the tissue of the other disease section
Head and neck cancer [ICD-11: 2D42]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Head and neck
The Specific Disease Head and neck cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.001394662; Fold-change: 0.07614474; Z-score: 0.355901487
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue
Download Antigen expression data in the tissue of healthy individual
Pituitary cancer [ICD-11: 2F37]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Pituitary
The Specific Disease Pituitary gonadotrope tumor
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.410273637; Fold-change: 0.043422444; Z-score: 0.186995619
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue
Download Antigen expression data in the tissue of healthy individual
The Studied Tissue Pituitary
The Specific Disease Pituitary cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.452975299; Fold-change: 0.026892947; Z-score: 0.085745056
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue
Download Antigen expression data in the tissue of healthy individual
ICD Disease Classification 03
Click to Show/Hide the 1 Disease of This Class
Thrombocytopenia [ICD-11: 3B64]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Whole blood
The Specific Disease Thrombocytopenia
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.20943322; Fold-change: 0.292469673; Z-score: 0.95083441
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue
Download Antigen expression data in the tissue of healthy individual
ICD Disease Classification 04
Click to Show/Hide the 2 Disease of This Class
Lupus erythematosus [ICD-11: 4A40]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Whole blood
The Specific Disease Lupus erythematosus
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.326591492; Fold-change: 0.054754131; Z-score: 0.125686791
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue
Download Antigen expression data in the tissue of healthy individual
Autoimmune disease [ICD-11: 4A4Z]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Peripheral monocyte
The Specific Disease Autoimmune uveitis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.035300531; Fold-change: -0.149620484; Z-score: -0.781422868
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue
Download Antigen expression data in the tissue of healthy individual
ICD Disease Classification 05
Click to Show/Hide the 1 Disease of This Class
Hyperlipoproteinaemia [ICD-11: 5C80]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Whole blood
The Specific Disease Familial hypercholesterolemia
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.01314782; Fold-change: 1.168189957; Z-score: 1.966150478
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue
Download Antigen expression data in the tissue of healthy individual
ICD Disease Classification 06
Click to Show/Hide the 1 Disease of This Class
Schizophrenia [ICD-11: 6A20]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Superior temporal cortex
The Specific Disease Schizophrenia
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.37136756; Fold-change: -0.065780164; Z-score: -0.574021833
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue
Download Antigen expression data in the tissue of healthy individual
ICD Disease Classification 08
Click to Show/Hide the 3 Disease of This Class
Multiple sclerosis [ICD-11: 8A40]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Spinal cord
The Specific Disease Multiple sclerosis
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.033176958; Fold-change: 0.253267881; Z-score: 1.318161465
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section
Download Antigen expression data of patients in the disease section of the tissue
The Studied Tissue Plasmacytoid dendritic cells
The Specific Disease Multiple sclerosis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.908087306; Fold-change: -0.014948565; Z-score: -0.067969155
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue
Download Antigen expression data in the tissue of healthy individual
Epilepsy [ICD-11: 8A60]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Peritumoral cortex
The Specific Disease Epilepsy
The Expression Level of Disease Section Compare with the Other Disease Section p-value: 0.806828639; Fold-change: 0.122562941; Z-score: 1.244686311
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue
Download Antigen expression data in the tissue of the other disease section
Cerebral ischaemic stroke [ICD-11: 8B11]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Whole blood
The Specific Disease Cardioembolic Stroke
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.453522582; Fold-change: -0.131792722; Z-score: -0.326981564
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue
Download Antigen expression data in the tissue of healthy individual
The Studied Tissue Peripheral blood
The Specific Disease Ischemic stroke
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.823939882; Fold-change: 0.166279443; Z-score: 0.31983768
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue
Download Antigen expression data in the tissue of healthy individual
ICD Disease Classification 1
Click to Show/Hide the 6 Disease of This Class
HIV [ICD-11: 1C60-1C62]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue White matter
The Specific Disease HIV
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.1901881; Fold-change: -0.049400641; Z-score: -0.344163342
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue
Download Antigen expression data in the tissue of healthy individual
Influenza [ICD-11: 1E30]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Whole blood
The Specific Disease Influenza
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.974074514; Fold-change: -0.064028937; Z-score: -0.250310446
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue
Download Antigen expression data in the tissue of healthy individual
Chronic hepatitis C [ICD-11: 1E51.1]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Whole blood
The Specific Disease Chronic hepatitis C
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.907360335; Fold-change: -0.026302613; Z-score: -0.105959246
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue
Download Antigen expression data in the tissue of healthy individual
Sepsis [ICD-11: 1G40-1G41]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Whole blood
The Specific Disease Sepsis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 2.27E-12; Fold-change: 0.30407662; Z-score: 1.047043083
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue
Download Antigen expression data in the tissue of healthy individual
Septic shock [ICD-11: 1G41]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Whole blood
The Specific Disease Septic shock
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 8.02E-23; Fold-change: 0.214907202; Z-score: 0.811367106
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue
Download Antigen expression data in the tissue of healthy individual
Pediatric respiratory syncytial virus infection [ICD-11: CA40.11]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Peripheral blood
The Specific Disease Pediatric respiratory syncytial virus infection
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.060780968; Fold-change: 0.32036186; Z-score: 0.711147081
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue
Download Antigen expression data in the tissue of healthy individual
ICD Disease Classification 11
Click to Show/Hide the 6 Disease of This Class
Essential hypertension [ICD-11: BA00]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Peripheral blood
The Specific Disease Essential hypertension
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.205238142; Fold-change: 0.172009555; Z-score: 0.785631954
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue
Download Antigen expression data in the tissue of healthy individual
Myocardial infarction [ICD-11: BA41]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Peripheral blood
The Specific Disease Myocardial infarction
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.154418881; Fold-change: 0.302516183; Z-score: 0.464345187
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue
Download Antigen expression data in the tissue of healthy individual
Coronary artery disease [ICD-11: BA8Z]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Peripheral blood
The Specific Disease Coronary artery disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.065578276; Fold-change: 0.203896086; Z-score: 1.434984057
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue
Download Antigen expression data in the tissue of healthy individual
Aortic stenosis [ICD-11: BB70]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Calcified aortic valve
The Specific Disease Aortic stenosis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.523500161; Fold-change: 0.045159165; Z-score: 0.15667097
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue
Download Antigen expression data in the tissue of healthy individual
Arteriosclerosis [ICD-11: BD40]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Peripheral blood
The Specific Disease Arteriosclerosis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.693921357; Fold-change: -0.017913328; Z-score: -0.166966297
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue
Download Antigen expression data in the tissue of healthy individual
Aneurysm [ICD-11: BD50]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Intracranial artery
The Specific Disease Aneurysm
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.002093649; Fold-change: -0.401021305; Z-score: -1.801664213
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue
Download Antigen expression data in the tissue of healthy individual
ICD Disease Classification 12
Click to Show/Hide the 8 Disease of This Class
Immunodeficiency [ICD-11: 4A00-4A20]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Peripheral blood
The Specific Disease Immunodeficiency
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.17203946; Fold-change: -0.033154337; Z-score: -0.27988384
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue
Download Antigen expression data in the tissue of healthy individual
Apnea [ICD-11: 7A40]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Hyperplastic tonsil
The Specific Disease Apnea
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.023519855; Fold-change: 0.131600413; Z-score: 0.951119911
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue
Download Antigen expression data in the tissue of healthy individual
Olive pollen allergy [ICD-11: CA08.00]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Peripheral blood
The Specific Disease Olive pollen allergy
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.818127406; Fold-change: 0.098262543; Z-score: 0.342614792
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue
Download Antigen expression data in the tissue of healthy individual
Chronic rhinosinusitis [ICD-11: CA0A]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Sinus mucosa
The Specific Disease Chronic rhinosinusitis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.070790175; Fold-change: 0.126488738; Z-score: 1.048195374
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue
Download Antigen expression data in the tissue of healthy individual
Chronic obstructive pulmonary disease [ICD-11: CA22]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Lung
The Specific Disease Chronic obstructive pulmonary disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.088477944; Fold-change: 0.104310288; Z-score: 0.633166351
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue
Download Antigen expression data in the tissue of healthy individual
The Studied Tissue Small airway epithelium
The Specific Disease Chronic obstructive pulmonary disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.03270724; Fold-change: 0.051297446; Z-score: 0.326761339
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue
Download Antigen expression data in the tissue of healthy individual
Asthma [ICD-11: CA23]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Nasal and bronchial airway
The Specific Disease Asthma
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.010947142; Fold-change: -0.073900138; Z-score: -0.217606231
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue
Download Antigen expression data in the tissue of healthy individual
Human rhinovirus infection [ICD-11: CA42]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Nasal Epithelium
The Specific Disease Human rhinovirus infection
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.314238117; Fold-change: 0.025282444; Z-score: 0.190483837
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue
Download Antigen expression data in the tissue of healthy individual
Idiopathic pulmonary fibrosis [ICD-11: CB03.4]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Lung
The Specific Disease Idiopathic pulmonary fibrosis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.70546204; Fold-change: 0.045560244; Z-score: 0.136090846
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue
Download Antigen expression data in the tissue of healthy individual
ICD Disease Classification 13
Click to Show/Hide the 5 Disease of This Class
Periodontal disease [ICD-11: DA0C]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Gingival
The Specific Disease Periodontal disease
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.006814717; Fold-change: 0.066530461; Z-score: 0.273065396
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section
Download Antigen expression data of patients in the disease section of the tissue
Eosinophilic gastritis [ICD-11: DA42.2]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Gastric antrum
The Specific Disease Eosinophilic gastritis
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.196957341; Fold-change: 0.082276691; Z-score: 0.605569242
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section
Download Antigen expression data of patients in the disease section of the tissue
Liver failure [ICD-11: DB99.7-DB99.8]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Liver
The Specific Disease Liver failure
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.532261514; Fold-change: 0.094440859; Z-score: 0.947277826
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue
Download Antigen expression data in the tissue of healthy individual
Ulcerative colitis [ICD-11: DD71]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Colon mucosal
The Specific Disease Ulcerative colitis
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.087406082; Fold-change: 0.21094257; Z-score: 0.734625151
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section
Download Antigen expression data of patients in the disease section of the tissue
Irritable bowel syndrome [ICD-11: DD91.0]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Rectal colon
The Specific Disease Irritable bowel syndrome
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.638409605; Fold-change: 0.056117715; Z-score: 0.230347282
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue
Download Antigen expression data in the tissue of healthy individual
ICD Disease Classification 14
Click to Show/Hide the 5 Disease of This Class
Atopic dermatitis [ICD-11: EA80]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Skin
The Specific Disease Atopic dermatitis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.389589109; Fold-change: -0.070628439; Z-score: -0.283474143
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue
Download Antigen expression data in the tissue of healthy individual
Psoriasis [ICD-11: EA90]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Skin
The Specific Disease Psoriasis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 8.95E-10; Fold-change: -0.27134286; Z-score: -0.89677687
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.004136246; Fold-change: 0.094413047; Z-score: 0.428325981
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section
Download Antigen expression data of patients in the disease section of the tissue
Download Antigen expression data in the tissue of healthy individual
Vitiligo [ICD-11: ED63.0]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Skin
The Specific Disease Vitiligo
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.605835073; Fold-change: 0.105379324; Z-score: 0.538764715
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue
Download Antigen expression data in the tissue of healthy individual
Alopecia [ICD-11: ED70]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Skin from scalp
The Specific Disease Alopecia
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.39915343; Fold-change: -0.038458272; Z-score: -0.275948371
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue
Download Antigen expression data in the tissue of healthy individual
Sensitive skin [ICD-11: EK0Z]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Skin
The Specific Disease Sensitive skin
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.780613584; Fold-change: 0.058998833; Z-score: 0.284890102
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue
Download Antigen expression data in the tissue of healthy individual
ICD Disease Classification 15
Click to Show/Hide the 6 Disease of This Class
Osteoarthritis [ICD-11: FA00-FA0Z]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Synovial
The Specific Disease Osteoarthritis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.426517656; Fold-change: -0.013921284; Z-score: -0.055251703
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue
Download Antigen expression data in the tissue of healthy individual
Arthropathy [ICD-11: FA00-FA5Z]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Peripheral blood
The Specific Disease Arthropathy
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.018329491; Fold-change: 0.375385642; Z-score: 1.224129708
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue
Download Antigen expression data in the tissue of healthy individual
Arthritis [ICD-11: FA20]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Peripheral blood
The Specific Disease Arthritis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 1.15E-10; Fold-change: 0.219038025; Z-score: 0.743688058
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue
Download Antigen expression data in the tissue of healthy individual
Rheumatoid arthritis [ICD-11: FA20]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Synovial
The Specific Disease Rheumatoid arthritis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.039231304; Fold-change: 0.259442635; Z-score: 0.642877923
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue
Download Antigen expression data in the tissue of healthy individual
Ankylosing spondylitis [ICD-11: FA92.0Z]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Pheripheral blood
The Specific Disease Ankylosing spondylitis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.77081132; Fold-change: 0.185509909; Z-score: 0.487635895
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue
Download Antigen expression data in the tissue of healthy individual
Osteoporosis [ICD-11: FB83]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Bone marrow
The Specific Disease Osteoporosis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.014394327; Fold-change: 0.909609768; Z-score: 2.789363737
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue
Download Antigen expression data in the tissue of healthy individual
ICD Disease Classification 16
Click to Show/Hide the 2 Disease of This Class
Endometriosis [ICD-11: GA10]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Endometrium
The Specific Disease Endometriosis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.678480726; Fold-change: 0.363090397; Z-score: 0.395784803
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue
Download Antigen expression data in the tissue of healthy individual
Interstitial cystitis [ICD-11: GC00.3]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Bladder
The Specific Disease Interstitial cystitis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.464108345; Fold-change: 0.050253872; Z-score: 0.606719961
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue
Download Antigen expression data in the tissue of healthy individual
ICD Disease Classification 19
Click to Show/Hide the 1 Disease of This Class
Preterm birth [ICD-11: KA21.4Z]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Myometrium
The Specific Disease Preterm birth
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.334607892; Fold-change: 0.420085619; Z-score: 1.234734914
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue
Download Antigen expression data in the tissue of healthy individual
ICD Disease Classification 2
Click to Show/Hide the 8 Disease of This Class
Acute myelocytic leukemia [ICD-11: 2A60]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Bone marrow
The Specific Disease Acute myelocytic leukemia
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 1.20E-08; Fold-change: -0.177290217; Z-score: -0.697396923
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue
Download Antigen expression data in the tissue of healthy individual
Myeloma [ICD-11: 2A83]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Peripheral blood
The Specific Disease Myeloma
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.15318286; Fold-change: 0.103641432; Z-score: 0.6099119
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue
Download Antigen expression data in the tissue of healthy individual
The Studied Tissue Bone marrow
The Specific Disease Myeloma
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.059126908; Fold-change: -0.264560541; Z-score: -0.538659546
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue
Download Antigen expression data in the tissue of healthy individual
Oral cancer [ICD-11: 2B6E]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Oral
The Specific Disease Oral cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.040023037; Fold-change: -0.15259567; Z-score: -0.590374617
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.756972273; Fold-change: -0.011457626; Z-score: -0.039821911
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section
Download Antigen expression data of patients in the disease section of the tissue
Download Antigen expression data in the tissue of healthy individual
Esophagal cancer [ICD-11: 2B70]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Esophagus
The Specific Disease Esophagal cancer
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.610495384; Fold-change: 0.009938352; Z-score: 0.028266183
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section
Download Antigen expression data of patients in the disease section of the tissue
Rectal cancer [ICD-11: 2B92]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Rectal colon
The Specific Disease Rectal cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.154035282; Fold-change: 0.164884982; Z-score: 0.795453961
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.033375364; Fold-change: 0.224661995; Z-score: 1.240101503
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section
Download Antigen expression data of patients in the disease section of the tissue
Download Antigen expression data in the tissue of healthy individual
Skin cancer [ICD-11: 2C30-2C3Z]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Skin
The Specific Disease Skin cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 3.25E-16; Fold-change: 0.124610479; Z-score: 0.324047205
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 1.39E-39; Fold-change: 0.495053651; Z-score: 1.681644499
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section
Download Antigen expression data of patients in the disease section of the tissue
Download Antigen expression data in the tissue of healthy individual
Renal cancer [ICD-11: 2C90-2C91]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Kidney
The Specific Disease Renal cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.575187389; Fold-change: -0.244646883; Z-score: -0.501044834
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 7.11E-33; Fold-change: -0.900590006; Z-score: -2.588647839
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section
Download Antigen expression data of patients in the disease section of the tissue
Download Antigen expression data in the tissue of healthy individual
Ureter cancer [ICD-11: 2C92]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Urothelium
The Specific Disease Ureter cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.678672326; Fold-change: 0.007481963; Z-score: 0.049440986
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue
Download Antigen expression data in the tissue of healthy individual
ICD Disease Classification 20
Click to Show/Hide the 2 Disease of This Class
Simpson golabi behmel syndrome [ICD-11: LD2C]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Adipose
The Specific Disease Simpson golabi behmel syndrome
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.536221526; Fold-change: 0.095855308; Z-score: 0.518076529
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue
Download Antigen expression data in the tissue of healthy individual
Tuberous sclerosis complex [ICD-11: LD2D.2]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Perituberal
The Specific Disease Tuberous sclerosis complex
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.019627855; Fold-change: 0.17872725; Z-score: 1.938087034
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue
Download Antigen expression data in the tissue of healthy individual
ICD Disease Classification 3
Click to Show/Hide the 3 Disease of This Class
Anemia [ICD-11: 3A00-3A9Z]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Bone marrow
The Specific Disease Anemia
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.487042094; Fold-change: -0.160838482; Z-score: -0.379531475
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue
Download Antigen expression data in the tissue of healthy individual
Sickle cell disease [ICD-11: 3A51.0-3A51.3]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Peripheral blood
The Specific Disease Sickle cell disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.003928671; Fold-change: 0.929509295; Z-score: 3.028560095
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue
Download Antigen expression data in the tissue of healthy individual
Thrombocythemia [ICD-11: 3B63]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Whole blood
The Specific Disease Thrombocythemia
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.001437679; Fold-change: 0.328298875; Z-score: 1.960536018
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue
Download Antigen expression data in the tissue of healthy individual
ICD Disease Classification 4
Click to Show/Hide the 4 Disease of This Class
Scleroderma [ICD-11: 4A42.Z]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Whole blood
The Specific Disease Scleroderma
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.958079804; Fold-change: -0.050560817; Z-score: -0.107357798
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue
Download Antigen expression data in the tissue of healthy individual
Sjogren syndrome [ICD-11: 4A43]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Salivary gland
The Specific Disease Sjogren syndrome
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.979073192; Fold-change: -0.057261336; Z-score: -0.541163615
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.31854143; Fold-change: -0.063119489; Z-score: -0.686542057
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section
Download Antigen expression data of patients in the disease section of the tissue
Download Antigen expression data in the tissue of healthy individual
Behcet disease [ICD-11: 4A62]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Peripheral blood
The Specific Disease Behcet disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.535582138; Fold-change: -0.019367804; Z-score: -0.040275123
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue
Download Antigen expression data in the tissue of healthy individual
Autosomal dominant monocytopenia [ICD-11: 4B04]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Whole blood
The Specific Disease Autosomal dominant monocytopenia
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.361523093; Fold-change: -0.140419048; Z-score: -0.471818834
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue
Download Antigen expression data in the tissue of healthy individual
ICD Disease Classification 5
Click to Show/Hide the 5 Disease of This Class
Type 2 diabetes [ICD-11: 5A11]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Liver
The Specific Disease Type 2 diabetes
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.451121202; Fold-change: -0.076626225; Z-score: -0.462292638
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue
Download Antigen expression data in the tissue of healthy individual
Polycystic ovary syndrome [ICD-11: 5A80.1]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Vastus lateralis muscle
The Specific Disease Polycystic ovary syndrome
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue
Obesity [ICD-11: 5B81]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Subcutaneous Adipose
The Specific Disease Obesity
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.212425711; Fold-change: -0.013302965; Z-score: -0.062249075
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue
Download Antigen expression data in the tissue of healthy individual
Pompe disease [ICD-11: 5C51.3]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Biceps muscle
The Specific Disease Pompe disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.039963297; Fold-change: -0.076666553; Z-score: -0.819249017
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue
Download Antigen expression data in the tissue of healthy individual
Batten disease [ICD-11: 5C56.1]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Whole blood
The Specific Disease Batten disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.667035065; Fold-change: 0.43854136; Z-score: 0.522274497
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue
Download Antigen expression data in the tissue of healthy individual
ICD Disease Classification 6
Click to Show/Hide the 2 Disease of This Class
Autism [ICD-11: 6A02]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Whole blood
The Specific Disease Autism
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.809394923; Fold-change: -0.076246324; Z-score: -0.174995294
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue
Download Antigen expression data in the tissue of healthy individual
Anxiety disorder [ICD-11: 6B00-6B0Z]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Whole blood
The Specific Disease Anxiety disorder
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.016827621; Fold-change: 0.197831278; Z-score: 0.469671089
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue
Download Antigen expression data in the tissue of healthy individual
ICD Disease Classification 8
Click to Show/Hide the 7 Disease of This Class
Parkinson disease [ICD-11: 8A00]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Substantia nigra
The Specific Disease Parkinson disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.412062612; Fold-change: -0.070052591; Z-score: -0.588927239
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue
Download Antigen expression data in the tissue of healthy individual
Huntington disease [ICD-11: 8A01]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Whole blood
The Specific Disease Huntington disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.399502297; Fold-change: -0.001999368; Z-score: -0.007740482
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue
Download Antigen expression data in the tissue of healthy individual
Alzheimer disease [ICD-11: 8A20]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Entorhinal cortex
The Specific Disease Alzheimer disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.0985915; Fold-change: 0.031642004; Z-score: 0.174071288
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue
Download Antigen expression data in the tissue of healthy individual
Seizure [ICD-11: 8A60-8A6Z]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Whole blood
The Specific Disease Seizure
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.007961344; Fold-change: -0.423703833; Z-score: -0.903570842
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue
Download Antigen expression data in the tissue of healthy individual
Lateral sclerosis [ICD-11: 8B60.4]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Skin
The Specific Disease Lateral sclerosis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.315224674; Fold-change: -0.634035703; Z-score: -1.174840861
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue
Download Antigen expression data in the tissue of healthy individual
The Studied Tissue Cervical spinal cord
The Specific Disease Lateral sclerosis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.240244305; Fold-change: 0.12381219; Z-score: 1.242388471
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue
Download Antigen expression data in the tissue of healthy individual
Muscular atrophy [ICD-11: 8C70]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Muscle
The Specific Disease Muscular atrophy
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.663315154; Fold-change: 0.036625518; Z-score: 0.202729037
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue
Download Antigen expression data in the tissue of healthy individual
Myopathy [ICD-11: 8C70.6]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Muscle
The Specific Disease Myopathy
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.726180742; Fold-change: 0.021490617; Z-score: 0.091144495
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue
Download Antigen expression data in the tissue of healthy individual
References
Ref 1 Activated platelets in the tumor microenvironment for targeting of antibody-drug conjugates to tumors and metastases. Theranostics. 2019 Feb 7;9(4):1154-1169. doi: 10.7150/thno.29146. eCollection 2019.

If you find any error in data or bug in web service, please kindly report it to Dr. Shen et al.