Antigen Information
General Information of This Antigen (ID: TAR0FMXJS)
| Antigen Name | SLAM family member 6 (SLAMF6) |
|||||
|---|---|---|---|---|---|---|
| Gene Name | SLAMF6 |
|||||
| Gene ID | ||||||
| Synonym | KALI; UNQ6123; PRO20080; Activating NK receptor;NK-T-B-antigen;CD352 |
|||||
| Sequence |
MLWLFQSLLFVFCFGPGNVVSQSSLTPLMVNGILGESVTLPLEFPAGEKVNFITWLFNET
SLAFIVPHETKSPEIHVTNPKQGKRLNFTQSYSLQLSNLKMEDTGSYRAQISTKTSAKLS SYTLRILRQLRNIQVTNHSQLFQNMTCELHLTCSVEDADDNVSFRWEALGNTLSSQPNLT VSWDPRISSEQDYTCIAENAVSNLSFSVSAQKLCEDVKIQYTDTKMILFMVSGICIVFGF IILLLLVLRKRRDSLSLSTQRTQGPAESARNLEYVSVSPTNNTVYASVTHSNRETEIWTP RENDTITIYSTINHSKESKPTFSRATALDNVV Click to Show/Hide
|
|||||
| Function |
Self-ligand receptor of the signaling lymphocytic activation molecule (SLAM) family. SLAM receptors triggered by homo- or heterotypic cell-cell interactions are modulating the activation and differentiation of a wide variety of immune cells and thus are involved in the regulation and interconnection of both innate and adaptive immune response. Activities are controlled by presence or absence of small cytoplasmic adapter proteins, SH2D1A/SAP and/or SH2D1B/EAT-2. Triggers cytolytic activity only in natural killer cells (NK) expressing high surface densities of natural cytotoxicity receptors. Positive signaling in NK cells implicates phosphorylation of VAV1. NK cell activation seems to depend on SH2D1B and not on SH2D1A. In conjunction with SLAMF1 controls the transition between positive selection and the subsequent expansion and differentiation of the thymocytic natural killer T (NKT) cell lineage. Promotes T-cell differentiation into a helper T-cell Th17 phenotype leading to increased IL-17 secretion; the costimulatory activity requires SH2D1A. Promotes recruitment of RORC to the IL-17 promoter. In conjunction with SLAMF1 and CD84/SLAMF5 may be a negative regulator of the humoral immune response. In the absence of SH2D1A/SAP can transmit negative signals to CD4(+) T- cells and NKT cells. Negatively regulates germinal center formation by inhibiting T-cell:B-cell adhesion; the function probably implicates increased association with PTPN6/SHP-1 via ITSMs in absence of SH2D1A/SAP. However, reported to be involved in maintaining B-cell tolerance in germinal centers and in preventing autoimmunity.
Click to Show/Hide
|
|||||
| Uniprot Entry | ||||||
| HGNC ID | ||||||
| KEGG ID | ||||||
Each Antibody-drug Conjugate and Its Component Related to This Antigen
Full List of The ADC Related to This Antigen
| The Numbers of ADCs, Their Three Components, Payload Targets, and Corresponding Diseases for This Antigens | ||||
|---|---|---|---|---|
Anti-SLAMF6 mAb
| ADC Name | Payload | Target | Linker | ADC Info |
|---|---|---|---|---|
|
CN107735105B ADC-1
[1]
|
CN107735105B ADC-1 payload |
Undisclosed |
CN107735105B ADC-1 linker |
|
|
CN107735105B ADC-2
[1]
|
CN107735105B ADC-2 payload |
Undisclosed |
CN107735105B ADC-2 linker |
|
|
CN107735105B ADC-3
[1]
|
CN107735105B ADC-3 payload |
Undisclosed |
CN107735105B ADC-3 linker |
h20F3
| ADC Name | Payload | Target | Linker | ADC Info |
|---|---|---|---|---|
|
TW201803600A ADC-7
[2]
|
PBD |
Undisclosed |
Undisclosed |
H20F3ec
| ADC Name | Payload | Target | Linker | ADC Info |
|---|---|---|---|---|
|
SGN-CD352A
|
PBD dimer |
Human deoxyribonucleic acid (hDNA) |
Val-Ala dipeptide linker |
References
