Antigen Information
General Information of This Antigen (ID: TAR0FMLBT)
| Antigen Name | HLA class II histocompatibility antigen, DR alpha chain (HLA-DRA) |
|||||
|---|---|---|---|---|---|---|
| Gene Name | HLA-DRA |
|||||
| Gene ID | ||||||
| Synonym | HLA-DRA1; MHC class II antigen DRA |
|||||
| Sequence |
MAISGVPVLGFFIIAVLMSAQESWAIKEEHVIIQAEFYLNPDQSGEFMFDFDGDEIFHVD
MAKKETVWRLEEFGRFASFEAQGALANIAVDKANLEIMTKRSNYTPITNVPPEVTVLTNS PVELREPNVLICFIDKFTPPVVNVTWLRNGKPVTTGVSETVFLPREDHLFRKFHYLPFLP STEDVYDCRVEHWGLDEPLLKHWEFDAPSPLPETTENVVCALGLTVGLVGIIIGTIFIIK GLRKSNAAERRGPL Click to Show/Hide
|
|||||
| Family | MHC class I family |
|||||
| Function |
An alpha chain of antigen-presenting major histocompatibility complex class II (MHCII) molecule. In complex with the beta chain HLA- DRB, displays antigenic peptides on professional antigen presenting cells (APCs) for recognition by alpha-beta T cell receptor (TCR) on HLA-DR-restricted CD4-positive T cells. This guides antigen-specific T- helper effector functions, both antibody-mediated immune response and macrophage activation, to ultimately eliminate the infectious agents and transformed cells. Typically presents extracellular peptide antigens of 10 to 30 amino acids that arise from proteolysis of endocytosed antigens in lysosomes. In the tumor microenvironment, presents antigenic peptides that are primarily generated in tumor-resident APCs likely via phagocytosis of apoptotic tumor cells or macropinocytosis of secreted tumor proteins. Presents peptides derived from intracellular proteins that are trapped in autolysosomes after macroautophagy, a mechanism especially relevant for T cell selection in the thymus and central immune tolerance. The selection of the immunodominant epitopes follows two processing modes: 'bind first, cut/trim later' for pathogen-derived antigenic peptides and 'cut first, bind later' for autoantigens/self- peptides. The anchor residue at position 1 of the peptide N-terminus, usually a large hydrophobic residue, is essential for high affinity interaction with MHCII molecules.
Click to Show/Hide
|
|||||
| Uniprot Entry | ||||||
| HGNC ID | ||||||
| KEGG ID | ||||||
Each Antibody-drug Conjugate and Its Component Related to This Antigen
Full List of The ADC Related to This Antigen
| The Numbers of ADCs, Their Three Components, Payload Targets, and Corresponding Diseases for This Antigens | ||||
|---|---|---|---|---|
IMMU-114
| ADC Name | Payload | Target | Linker | ADC Info |
|---|---|---|---|---|
|
IMMU-140
[1]
|
Active metabolite of irinotecan SN38 |
DNA topoisomerase 1 (TOP1) |
CL2A |
LYM-1
| ADC Name | Payload | Target | Linker | ADC Info |
|---|---|---|---|---|
|
Monoclonal antibody LYM-1-gelonin conjugate
[2]
|
Gelonin |
Ribosome (RB) |
N-succinimidyl 3-(2-pyridyldithio) propionate (SPDP) |
References
