Antigen ID	TAR0EHHCN
Antigen Name	T-cell surface glycoprotein CD5 (CD5)
Gene Name	CD5
Gene ID	921
Synonym	LEU1; Lymphocyte antigen T1/Leu-1;CD_antigen=CD5
Sequence	MPMGSLQPLATLYLLGMLVASCLGRLSWYDPDFQARLTRSNSKCQGQLEVYLKDGWHMVC SQSWGRSSKQWEDPSQASKVCQRLNCGVPLSLGPFLVTYTPQSSIICYGQLGSFSNCSHS RNDMCHSLGLTCLEPQKTTPPTTRPPPTTTPEPTAPPRLQLVAQSGGQHCAGVVEFYSGS LGGTISYEAQDKTQDLENFLCNNLQCGSFLKHLPETEAGRAQDPGEPREHQPLPIQWKIQ NSSCTSLEHCFRKIKPQKSGRVLALLCSGFQPKVQSRLVGGSSICEGTVEVRQGAQWAAL CDSSSARSSLRWEEVCREQQCGSVNSYRVLDAGDPTSRGLFCPHQKLSQCHELWERNSYC KKVFVTCQDPNPAGLAAGTVASIILALVLLVVLLVVCGPLAYKKLVKKFRQKKQRQWIGP TGMNQNMSFHRNHTATVRSHAENPTASHVDNEYSQPPRNSHLSAYPALEGALHRSSMQPD NSSDSDYDLHGAQRL     Click to Show/Hide
Function	May act as a receptor in regulating T-cell proliferation.     Click to Show/Hide
Uniprot Entry	CD5_HUMAN
HGNC ID	HGNC:1685
KEGG ID	hsa:921

ADC Info	ADC Name	Payload	Target	Linker	Ref
ADC Info	Telimomab aritox	Ricin A-chain	Ribosome (RB)	Undisclosed	[1]

ADC Info	ADC Name	Payload	Target	Linker	Ref
ADC Info	CD5 5D7 D265C/H435A ADC A	Amaninamide (thioether)	DNA-directed RNA polymerase II subunit RPB2 (POLR2B); DNA-directed RNA polymerase III subunit RPC7 (POLR3G)	Mc-Val-Ala-PABC	[2]
ADC Info	CD5 5D7 D265C/H435A ADC C	Alpha-amanitin (thioether)	DNA-directed RNA polymerase II subunit RPB2 (POLR2B); DNA-directed RNA polymerase III subunit RPC7 (POLR3G)	Maleimido-caproyl	[2]

Differential expression pattern of antigen in diseases
The Studied Tissue	Gingival
The Specific Disease	Bacterial infection of gingival
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 2.93E-07; Fold-change: 0.215103964; Z-score: 0.77338698
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Brainstem
The Specific Disease	Glioma
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.64467525; Fold-change: 0.03394342; Z-score: 0.392338813
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual
The Studied Tissue	White matter
The Specific Disease	Glioma
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.003930664; Fold-change: -0.371018005; Z-score: -2.22485859
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual
The Studied Tissue	Brainstem
The Specific Disease	Neuroectodermal tumor
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 6.15E-05; Fold-change: -0.655494629; Z-score: -2.232739961
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual
The Studied Tissue	Nervous
The Specific Disease	Brain cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 7.57E-15; Fold-change: -0.123689594; Z-score: -0.49886414
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Whole blood
The Specific Disease	Polycythemia vera
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 2.57E-13; Fold-change: -0.304276758; Z-score: -2.128331225
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual
The Studied Tissue	Whole blood
The Specific Disease	Myelofibrosis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.000493471; Fold-change: -0.370487294; Z-score: -2.447529395
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Bone marrow
The Specific Disease	Myelodysplastic syndromes
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.175084664; Fold-change: 0.044381217; Z-score: 0.172278061
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 0.002548099; Fold-change: -3.632061105; Z-score: -4.730885326
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Tonsil
The Specific Disease	Lymphoma
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.968595378; Fold-change: 0.018306227; Z-score: 0.069108152
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Gastric
The Specific Disease	Gastric cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.569160416; Fold-change: -0.18075693; Z-score: -0.744864343
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 0.048058778; Fold-change: 0.14375648; Z-score: 0.451397339
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Colon
The Specific Disease	Colon cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 1.64E-07; Fold-change: -0.156530165; Z-score: -0.582478894
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 1.45E-05; Fold-change: -0.161488262; Z-score: -0.604390904
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Pancreas
The Specific Disease	Pancreatic cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.040499901; Fold-change: -0.246152912; Z-score: -0.473472732
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 3.12E-06; Fold-change: -0.313347439; Z-score: -0.878822746
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Liver
The Specific Disease	Liver cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.73240309; Fold-change: -0.026392555; Z-score: -0.136827919
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 9.64E-06; Fold-change: -0.114698104; Z-score: -0.456360162
The Expression Level of Disease Section Compare with the Other Disease Section	p-value: 0.869714912; Fold-change: -0.013274199; Z-score: -0.056135149
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual Download Antigen expression data in the tissue of the other disease section

Differential expression pattern of antigen in diseases
The Studied Tissue	Lung
The Specific Disease	Lung cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.053731462; Fold-change: -0.058477626; Z-score: -0.161965799
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 8.67E-07; Fold-change: -0.244152858; Z-score: -0.620304088
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Skin
The Specific Disease	Melanoma
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.021730046; Fold-change: 0.512824783; Z-score: 1.184726128
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Muscle
The Specific Disease	Sarcoma
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 9.20E-38; Fold-change: -0.264553602; Z-score: -1.216975431
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 0.002763988; Fold-change: -0.554849983; Z-score: -4.353076545
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Breast
The Specific Disease	Breast cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 5.76E-14; Fold-change: 0.119009235; Z-score: 0.467446885
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 0.038729509; Fold-change: 0.05346419; Z-score: 0.163018291
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Ovarian
The Specific Disease	Ovarian cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.337105836; Fold-change: -0.190592093; Z-score: -0.683997957
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 0.541678493; Fold-change: -0.084404376; Z-score: -0.370309394
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Cervical
The Specific Disease	Cervical cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.393000462; Fold-change: -0.001956767; Z-score: -0.008958469
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Endometrium
The Specific Disease	Uterine cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 2.01E-08; Fold-change: 0.227086731; Z-score: 0.7194923
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 7.39E-10; Fold-change: 0.563253895; Z-score: 10.91735588
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Prostate
The Specific Disease	Prostate cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 3.01E-05; Fold-change: -0.788224245; Z-score: -1.456402317
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Bladder
The Specific Disease	Bladder cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.024107609; Fold-change: 0.278719359; Z-score: 1.055647782
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Uvea
The Specific Disease	Retinoblastoma tumor
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.001391687; Fold-change: -0.371490194; Z-score: -1.857715853
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Thyroid
The Specific Disease	Thyroid cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.758073433; Fold-change: 0.058780448; Z-score: 0.084116637
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 0.023272363; Fold-change: 0.150992535; Z-score: 0.340030505
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Adrenal cortex
The Specific Disease	Adrenocortical carcinoma
The Expression Level of Disease Section Compare with the Other Disease Section	p-value: 0.577403218; Fold-change: -0.128086455; Z-score: -0.780232126
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of the other disease section

Differential expression pattern of antigen in diseases
The Studied Tissue	Head and neck
The Specific Disease	Head and neck cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.008219372; Fold-change: 0.226886344; Z-score: 0.432180035
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Pituitary
The Specific Disease	Pituitary gonadotrope tumor
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.083808788; Fold-change: 0.164409509; Z-score: 0.822549918
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual
The Studied Tissue	Pituitary
The Specific Disease	Pituitary cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.089703192; Fold-change: 0.321119462; Z-score: 1.004520062
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Whole blood
The Specific Disease	Thrombocytopenia
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.842930446; Fold-change: 0.337847857; Z-score: 0.386379568
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Whole blood
The Specific Disease	Lupus erythematosus
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 2.41E-06; Fold-change: -0.356718814; Z-score: -0.553985047
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Peripheral monocyte
The Specific Disease	Autoimmune uveitis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.349822024; Fold-change: -0.044870695; Z-score: -0.431865814
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Whole blood
The Specific Disease	Familial hypercholesterolemia
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 1.19E-11; Fold-change: -1.85039618; Z-score: -2.164677167
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Superior temporal cortex
The Specific Disease	Schizophrenia
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.373294704; Fold-change: -0.021485021; Z-score: -0.264618601
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Spinal cord
The Specific Disease	Multiple sclerosis
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 0.283729368; Fold-change: -0.069572692; Z-score: -0.681365619
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section Download Antigen expression data of patients in the disease section of the tissue
The Studied Tissue	Plasmacytoid dendritic cells
The Specific Disease	Multiple sclerosis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.729686364; Fold-change: -0.114366892; Z-score: -0.343422054
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Peritumoral cortex
The Specific Disease	Epilepsy
The Expression Level of Disease Section Compare with the Other Disease Section	p-value: 0.284778851; Fold-change: 0.05774437; Z-score: 0.79083991
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of the other disease section

Differential expression pattern of antigen in diseases
The Studied Tissue	Whole blood
The Specific Disease	Cardioembolic Stroke
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 6.72E-05; Fold-change: -0.382812516; Z-score: -1.156911473
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual
The Studied Tissue	Peripheral blood
The Specific Disease	Ischemic stroke
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.337968739; Fold-change: 0.092796463; Z-score: 0.128549463
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	White matter
The Specific Disease	HIV
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.012475952; Fold-change: -0.127072935; Z-score: -0.620344934
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Whole blood
The Specific Disease	Influenza
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.636262724; Fold-change: 0.222133071; Z-score: 0.850848695
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Whole blood
The Specific Disease	Chronic hepatitis C
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.00751211; Fold-change: -0.286447407; Z-score: -1.301866916
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Whole blood
The Specific Disease	Sepsis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 2.66E-32; Fold-change: -0.950935804; Z-score: -2.411577997
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Whole blood
The Specific Disease	Septic shock
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 8.86E-78; Fold-change: -0.698689156; Z-score: -2.381166404
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Peripheral blood
The Specific Disease	Pediatric respiratory syncytial virus infection
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.001356992; Fold-change: -0.310274824; Z-score: -1.069396264
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Peripheral blood
The Specific Disease	Essential hypertension
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.551606355; Fold-change: 0.016613329; Z-score: 0.166283059
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Peripheral blood
The Specific Disease	Myocardial infarction
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.590053767; Fold-change: -0.73735104; Z-score: -1.013115293
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Peripheral blood
The Specific Disease	Coronary artery disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.711739577; Fold-change: -0.038381925; Z-score: -0.061917621
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Calcified aortic valve
The Specific Disease	Aortic stenosis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.641092717; Fold-change: 0.138197921; Z-score: 0.25142258
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Peripheral blood
The Specific Disease	Arteriosclerosis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.017981779; Fold-change: 0.173848844; Z-score: 0.729617003
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Intracranial artery
The Specific Disease	Aneurysm
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.006010309; Fold-change: 0.353903076; Z-score: 1.693361802
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Peripheral blood
The Specific Disease	Immunodeficiency
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.082156795; Fold-change: 0.268288726; Z-score: 1.264769762
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Hyperplastic tonsil
The Specific Disease	Apnea
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.626885293; Fold-change: -0.049121383; Z-score: -0.216433131
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Peripheral blood
The Specific Disease	Olive pollen allergy
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.366323702; Fold-change: 0.194711068; Z-score: 0.312279991
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Sinus mucosa
The Specific Disease	Chronic rhinosinusitis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.246132973; Fold-change: 0.095924152; Z-score: 0.704030977
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Lung
The Specific Disease	Chronic obstructive pulmonary disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.079126115; Fold-change: 0.033225457; Z-score: 0.124173425
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual
The Studied Tissue	Small airway epithelium
The Specific Disease	Chronic obstructive pulmonary disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.041813566; Fold-change: 0.057571488; Z-score: 0.239789335
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Nasal and bronchial airway
The Specific Disease	Asthma
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.655240591; Fold-change: 0.040541152; Z-score: 0.1341766
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Nasal Epithelium
The Specific Disease	Human rhinovirus infection
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.891315573; Fold-change: -0.017389954; Z-score: -0.122486763
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Lung
The Specific Disease	Idiopathic pulmonary fibrosis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.069546135; Fold-change: 0.240994079; Z-score: 1.115550543
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Gingival
The Specific Disease	Periodontal disease
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 2.31E-08; Fold-change: 0.248405226; Z-score: 0.919191263
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section Download Antigen expression data of patients in the disease section of the tissue

Differential expression pattern of antigen in diseases
The Studied Tissue	Gastric antrum
The Specific Disease	Eosinophilic gastritis
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 0.062831138; Fold-change: 0.315160011; Z-score: 2.83267596
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section Download Antigen expression data of patients in the disease section of the tissue

Differential expression pattern of antigen in diseases
The Studied Tissue	Liver
The Specific Disease	Liver failure
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.000342227; Fold-change: 0.346119555; Z-score: 1.734951146
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Colon mucosal
The Specific Disease	Ulcerative colitis
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 0.00110715; Fold-change: 0.270877394; Z-score: 1.006655606
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section Download Antigen expression data of patients in the disease section of the tissue

Differential expression pattern of antigen in diseases
The Studied Tissue	Rectal colon
The Specific Disease	Irritable bowel syndrome
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.283960507; Fold-change: -0.038447568; Z-score: -0.116691383
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Skin
The Specific Disease	Atopic dermatitis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 4.47E-05; Fold-change: 0.149080031; Z-score: 1.279889443
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Skin
The Specific Disease	Psoriasis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.000681639; Fold-change: 0.122502647; Z-score: 0.429984191
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 4.95E-28; Fold-change: 0.732054376; Z-score: 1.791074944
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Skin
The Specific Disease	Vitiligo
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.722669248; Fold-change: -0.034236151; Z-score: -0.201336582
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Skin from scalp
The Specific Disease	Alopecia
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.717386263; Fold-change: -0.098817795; Z-score: -0.319875569
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Skin
The Specific Disease	Sensitive skin
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.708939998; Fold-change: 0.01375351; Z-score: 0.042159926
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Synovial
The Specific Disease	Osteoarthritis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.077964323; Fold-change: -0.278203085; Z-score: -0.785247064
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Peripheral blood
The Specific Disease	Arthropathy
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.04164097; Fold-change: -0.420735882; Z-score: -1.751980785
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Peripheral blood
The Specific Disease	Arthritis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 4.07E-09; Fold-change: -0.424328379; Z-score: -0.989400451
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Synovial
The Specific Disease	Rheumatoid arthritis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.065557906; Fold-change: -0.314689915; Z-score: -0.843717581
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Pheripheral blood
The Specific Disease	Ankylosing spondylitis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.003215119; Fold-change: -0.22282519; Z-score: -1.56042782
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Bone marrow
The Specific Disease	Osteoporosis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.1659908; Fold-change: 0.078141113; Z-score: 0.603823907
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Endometrium
The Specific Disease	Endometriosis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.148373001; Fold-change: 0.141336578; Z-score: 0.613699467
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Bladder
The Specific Disease	Interstitial cystitis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 9.68E-05; Fold-change: 0.677939965; Z-score: 3.062919704
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Myometrium
The Specific Disease	Preterm birth
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.462155075; Fold-change: -0.016471912; Z-score: -0.111331844
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Bone marrow
The Specific Disease	Acute myelocytic leukemia
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 1.46E-17; Fold-change: -0.575795474; Z-score: -0.989004064
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Bone marrow
The Specific Disease	Myeloma
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.012627564; Fold-change: -0.185319423; Z-score: -0.829028835
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual
The Studied Tissue	Peripheral blood
The Specific Disease	Myeloma
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.314000342; Fold-change: 0.088345775; Z-score: 0.367225313
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Oral
The Specific Disease	Oral cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 1.37E-06; Fold-change: -0.336888928; Z-score: -1.255692135
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 0.754074044; Fold-change: 0.038072787; Z-score: 0.120845728
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Esophagus
The Specific Disease	Esophagal cancer
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 0.475738738; Fold-change: -0.304502237; Z-score: -0.839171959
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section Download Antigen expression data of patients in the disease section of the tissue

Differential expression pattern of antigen in diseases
The Studied Tissue	Rectal colon
The Specific Disease	Rectal cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.199442935; Fold-change: -0.051678897; Z-score: -0.427966814
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 0.065711392; Fold-change: -0.17123703; Z-score: -1.024878605
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Skin
The Specific Disease	Skin cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.800900495; Fold-change: 0.032523829; Z-score: 0.086486126
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 7.29E-17; Fold-change: 0.61376889; Z-score: 1.151788476
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Kidney
The Specific Disease	Renal cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.353143065; Fold-change: -0.060726902; Z-score: -0.251267747
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 1.09E-08; Fold-change: -0.43300622; Z-score: -1.320618535
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Urothelium
The Specific Disease	Ureter cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.469100444; Fold-change: -0.06124971; Z-score: -0.22413641
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Adipose
The Specific Disease	Simpson golabi behmel syndrome
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.049535374; Fold-change: 0.271266307; Z-score: 7.952906972
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Perituberal
The Specific Disease	Tuberous sclerosis complex
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.499459983; Fold-change: 0.036300095; Z-score: 0.170231113
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Bone marrow
The Specific Disease	Anemia
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.727015026; Fold-change: 0.111153441; Z-score: 0.306766692
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Peripheral blood
The Specific Disease	Sickle cell disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.010160408; Fold-change: -0.239160017; Z-score: -0.988340775
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Whole blood
The Specific Disease	Thrombocythemia
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 7.12E-09; Fold-change: -0.306712233; Z-score: -1.913329392
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Whole blood
The Specific Disease	Scleroderma
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.00036949; Fold-change: -0.349030138; Z-score: -1.75633288
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Salivary gland
The Specific Disease	Sjogren syndrome
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.837448866; Fold-change: 0.099185411; Z-score: 0.36416596
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 0.007925293; Fold-change: -0.715655046; Z-score: -2.861232904
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Peripheral blood
The Specific Disease	Behcet disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.4218417; Fold-change: -0.035375329; Z-score: -0.078398234
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Whole blood
The Specific Disease	Autosomal dominant monocytopenia
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.237131641; Fold-change: -0.295665525; Z-score: -1.086606918
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Liver
The Specific Disease	Type 2 diabetes
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.651273264; Fold-change: 0.021448321; Z-score: 0.581412788
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Vastus lateralis muscle
The Specific Disease	Polycystic ovary syndrome
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.978802247; Fold-change: -0.020993128; Z-score: -0.191740287
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Subcutaneous Adipose
The Specific Disease	Obesity
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.427667915; Fold-change: -0.017733493; Z-score: -0.169297191
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Biceps muscle
The Specific Disease	Pompe disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.122298466; Fold-change: -0.091530429; Z-score: -0.402465542
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Whole blood
The Specific Disease	Batten disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.360792585; Fold-change: -0.196776988; Z-score: -0.775373824
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Whole blood
The Specific Disease	Autism
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.018372428; Fold-change: -0.199016927; Z-score: -0.667046952
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Whole blood
The Specific Disease	Anxiety disorder
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.173199893; Fold-change: -0.193541162; Z-score: -0.455412048
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Substantia nigra
The Specific Disease	Parkinson disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.795675228; Fold-change: -0.010871657; Z-score: -0.060083312
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Whole blood
The Specific Disease	Huntington disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.784500468; Fold-change: 0.165622318; Z-score: 0.386355642
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Entorhinal cortex
The Specific Disease	Alzheimer disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.01310694; Fold-change: -0.048844603; Z-score: -0.392529001
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Whole blood
The Specific Disease	Seizure
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.849029503; Fold-change: 0.21458875; Z-score: 0.351439802
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Skin
The Specific Disease	Lateral sclerosis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.33207854; Fold-change: 0.082892781; Z-score: 0.543146886
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual
The Studied Tissue	Cervical spinal cord
The Specific Disease	Lateral sclerosis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.822541039; Fold-change: 0.173327571; Z-score: 0.619547788
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Muscle
The Specific Disease	Muscular atrophy
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.138122844; Fold-change: -0.122417079; Z-score: -0.813569595
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Muscle
The Specific Disease	Myopathy
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.070098671; Fold-change: 0.119301089; Z-score: 0.88369165
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Ref 1	Effects of therapy with T101 ricin A-chain immunotoxin in two leukemia patients. Blood. 1986 Jun;67(6):1680-7.
Ref 2	Amatoxin antibody-drug conjugates and uses thereof; 2020-10-29.