Target Information
General Information of This Target
| Target ID | PATR0XOETL |
|||||
|---|---|---|---|---|---|---|
| Target Name | Peptidyl-prolyl cis-trans isomerase FKBP1A (FKBP1A) |
|||||
| Gene Name | FKBP1A |
|||||
| Gene ID | ||||||
| Synonym | FKBP1; FKBP12; PPIase FKBP1A; 12 kDa FK506-binding protein (12 kDa FKBP; FKBP-12); Calstabin-1; FK506-binding protein 1A (FKBP-1A); Immunophilin FKBP12; Rotamase |
|||||
| Sequence |
MGVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDRNKPFKFMLGKQEVIRGW
EEGVAQMSVGQRAKLTISPDYAYGATGHPGIIPPHATLVFDVELLKLE Click to Show/Hide
|
|||||
| Family | the FKBP-type PPIase family. FKBP1 subfamily |
|||||
| Function |
Keeps in an inactive conformation TGFBR1, the TGF-beta type I serine/threonine kinase receptor, preventing TGF-beta receptor activation in absence of ligand. Recruits SMAD7 to ACVR1B which prevents the association of SMAD2 and SMAD3 with the activin receptor complex, thereby blocking the activin signal. May modulate the RYR1 calcium channel activity. PPIases accelerate the folding of proteins. It catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides.
Click to Show/Hide
|
|||||
| Uniprot Entry | ||||||
| HGNC ID | ||||||
| KEGG ID | ||||||
Full List of The ADC Related to This Target
Terminated
| ADC Info | ADC Name | Antibody | Antigen | Payload | Linker | Ref |
|---|---|---|---|---|---|---|
CD184-tacrolimus antibody drug conjugate |
Undisclosed |
CXCR4 |
Tacrolimus |
Undisclosed |
[1] |
