Target Information
General Information of This Target
| Target ID | PATR0EDEOC |
|||||
|---|---|---|---|---|---|---|
| Target Name | Bcl-2-like protein 1 (BCL2L1) |
|||||
| Gene Name | BCL2L1 |
|||||
| Gene ID | ||||||
| Synonym | Apoptosis regulator Bcl-X; BCL2L1; BCL2L; BCLX |
|||||
| Sequence |
MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESEMETPSAINGNPSWHLA
DSPAVNGATGHSSSLDAREVIPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAY QSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQVLVSRIAAWMATYLNDHLEP WIQENGGWDTFVELYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK Click to Show/Hide
|
|||||
| Family | Bcl-2 family |
|||||
| Function |
Potent inhibitor of cell death. Inhibits activation of caspases. Appears to regulate cell death by blocking the voltage-dependent anion channel (VDAC) by binding to it and preventing the release of the caspase activator, CYC1, from the mitochondrial membrane. Also acts as a regulator of G2 checkpoint and progression to cytokinesis during mitosis. Isoform Bcl-X(L) also regulates presynaptic plasticity, including neurotransmitter release and recovery, number of axonal mitochondria as well as size and number of synaptic vesicle clusters. During synaptic stimulation, increases ATP availability from mitochondria through regulation of mitochondrial membrane ATP synthase F1F0 activity and regulates endocytic vesicle retrieval in hippocampal neurons through association with DMN1L and stimulation of its GTPase activity in synaptic vesicles. May attenuate inflammation impairing NLRP1-inflammasome activation, hence CASP1 activation and IL1B release.
Click to Show/Hide
|
|||||
| Uniprot Entry | ||||||
| HGNC ID | ||||||
| KEGG ID | ||||||
Full List of The ADC Related to This Target
Phase 1
| ADC Info | ADC Name | Antibody | Antigen | Payload | Linker | Ref |
|---|---|---|---|---|---|---|
ABBV-637 |
Undisclosed |
EGFR |
BCL-XL inhibitor |
Undisclosed |
||
Mirzotamab clezutoclax |
Mirzotamab |
CD276 |
Clezutoclax |
Valine-alanine (cleavable linker) |
[1] |
References
