Antibody Information

General Information of This Antibody

Antibody ID	ANTI0TKAVC
Antibody Name	NY920
Organization	z
Synonyms	NY920 Click to Show/Hide
Antibody Type	Monoclonal antibody (mAb)
Antibody Subtype	Humanized lgG
Antigen Name	CD48 antigen (CD48)	Antigen Info
Click to Show/Hide the Sequence Information of This Antibody
Heavy Chain Sequence	EVOLLESGGGLVQPGGSLRLSCAASGFTFSSFAMSWVRQAPGKGLEWVSAISGFGGSTYY ADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARQFWEDQPFYFDYWGQGTLVTVS SASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPCPVTVSWNSGALTSGVHTFPAVLQS SGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPKSCDKTHTCPPCPAPELLG GPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQY NSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRE EMTKNQVSLTCLVKGFYPCDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSR WQQGNVFSCSVMHEALHNHYTQKSLSLSPGK Click to Show/Hide
Light Chain Sequence	DIQMTQSPSSLSASVGDRVTITCRASQSISSYLNWYQQKPGKAPKLLIYAASSLQSGVPS RFSGSGSGTDFTLTISSLOPEDFATYYCQQSYSTPLTFGQGTKVEIKRTVAAPSVFIFPP SDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLT LSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC Click to Show/Hide

Each Antibody-drug Conjugate Related to This Antibody

Full Information of The Activity Data of The ADC(s) Related to This Antibody

NY920-P1-L12-P4 [Investigative]

ADC Info

Revealed Based on the Cell Line Data

Click To Hide/Show 9 Activity Data Related to This Level

Experiment 1 Reporting the Activity Date of This ADC					[1]
Efficacy Data	Half Maximal inhibitory Concentration (lC50)	0.011 nM	High CD48 expression (CD48 +++)
Method Description	NY920-P1-L12-P4 was tested in KMS-27
In Vitro Model	Plasma cell myeloma, Multiple myeloma	KMS-27 cells		CVCL_2993
Experiment 2 Reporting the Activity Date of This ADC					[1]
Efficacy Data	Half Maximal inhibitory Concentration (lC50)	0.027 nM	High CD48 expression (CD48 +++)
Method Description	NY920-P1-L12-P4 was tested in Ke97
In Vitro Model	Bladder carcinoma	Ke97 cells		CVCL_3386
Experiment 3 Reporting the Activity Date of This ADC					[1]
Efficacy Data	Half Maximal inhibitory Concentration (lC50)	0.036 nM	High CD48 expression (CD48 +++)
Method Description	NY920-P1-L12-P4 was tested in KHM-1B
In Vitro Model	Plasma cell myeloma, Multiple myeloma	KHM-1B cells		CVCL_2972
Experiment 4 Reporting the Activity Date of This ADC					[1]
Efficacy Data	Half Maximal inhibitory Concentration (lC50)	0.07 nM	High CD48 expression (CD48 +++)
Method Description	NY920-P1-L12-P4 was tested in NCI-H929
In Vitro Model	Plasma cell myeloma	NCI-H929 cells		CVCL_1600
Experiment 5 Reporting the Activity Date of This ADC					[1]
Efficacy Data	Half Maximal inhibitory Concentration (lC50)	0.254 nM	High CD48 expression (CD48 +++)
Method Description	NY920-P1-L12-P4 was tested in KMS-21-BM
In Vitro Model	Multiple myeloma	KMS-21-BM cells		CVCL_2991
Experiment 6 Reporting the Activity Date of This ADC					[1]
Efficacy Data	Half Maximal inhibitory Concentration (lC50)	0.531 nM	High CD48 expression (CD48 +++)
Method Description	NY920-P1-L12-P4 was tested in AMO-1
In Vitro Model	Multiple myeloma, Plasma cell myeloma	AMO-1 cells		CVCL_1806
Experiment 7 Reporting the Activity Date of This ADC					[1]
Efficacy Data	Half Maximal inhibitory Concentration (lC50)	> 10 nM	High CD48 expression (CD48 +++)
Method Description	NY920-P1-L12-P4 was tested in MOLP-8
In Vitro Model	Plasma cell myeloma	MOLP-8 cells		CVCL_2124
Experiment 8 Reporting the Activity Date of This ADC					[1]
Efficacy Data	Half Maximal inhibitory Concentration (lC50)	19.67 nM	High CD48 expression (CD48 +++)
Method Description	NY920-P1-L12-P4 was tested in RL
In Vitro Model	Diffuse large B-cell lymphoma	RL cells		CVCL_1660
Experiment 9 Reporting the Activity Date of This ADC					[1]
Efficacy Data	Half Maximal inhibitory Concentration (lC50)	< 50 nM	High CD48 expression (CD48 +++)
Method Description	NY920-P1-L12-P4 was tested in WSU-DLCL2
In Vitro Model	Diffuse large B-cell lymphoma	WSU-DLCL2 cells		CVCL_1902

NY920-P1-L17-P4 [Investigative]

ADC Info

Revealed Based on the Cell Line Data

Click To Hide/Show 9 Activity Data Related to This Level

Experiment 1 Reporting the Activity Date of This ADC					[1]
Efficacy Data	Half Maximal inhibitory Concentration (lC50)	0.031 nM	High CD48 expression (CD48 +++)
Method Description	NY920-P1-L17-P4 was tested in KNM-1B
In Vitro Model	Plasma cell myeloma, Multiple myeloma	KHM-1B cells		CVCL_2972
Experiment 2 Reporting the Activity Date of This ADC					[1]
Efficacy Data	Half Maximal inhibitory Concentration (lC50)	0.041 nM	High CD48 expression (CD48 +++)
Method Description	NY920-P1-L17-P4 was tested in KMS-27
In Vitro Model	Plasma cell myeloma, Multiple myeloma	KMS-27 cells		CVCL_2993
Experiment 3 Reporting the Activity Date of This ADC					[1]
Efficacy Data	Half Maximal inhibitory Concentration (lC50)	0.133 nM	High CD48 expression (CD48 +++)
Method Description	NY920-P1-L17-P4 was tested in NCI-H929
In Vitro Model	Plasma cell myeloma	NCI-H929 cells		CVCL_1600
Experiment 4 Reporting the Activity Date of This ADC					[1]
Efficacy Data	Half Maximal inhibitory Concentration (lC50)	0.33 nM	High CD48 expression (CD48 +++)
Method Description	NY920-P1-L17-P4 was tested in KMS-21-BM
In Vitro Model	Multiple myeloma	KMS-21-BM cells		CVCL_2991
Experiment 5 Reporting the Activity Date of This ADC					[1]
Efficacy Data	Half Maximal inhibitory Concentration (lC50)	1.11 nM	High CD48 expression (CD48 +++)
Method Description	NY920-P1-L17-P4 was tested in Ke97
In Vitro Model	Bladder carcinoma	Ke97 cells		CVCL_3386
Experiment 6 Reporting the Activity Date of This ADC					[1]
Efficacy Data	Half Maximal inhibitory Concentration (lC50)	1.48 nM	High CD48 expression (CD48 +++)
Method Description	NY920-P1-L17-P4 was tested in WSU-DLCL2
In Vitro Model	Diffuse large B-cell lymphoma	WSU-DLCL2 cells		CVCL_1902
Experiment 7 Reporting the Activity Date of This ADC					[1]
Efficacy Data	Half Maximal inhibitory Concentration (lC50)	1.49 nM	High CD48 expression (CD48 +++)
Method Description	NY920-P1-L17-P4 was tested in AMO-1
In Vitro Model	Multiple myeloma, Plasma cell myeloma	AMO-1 cells		CVCL_1806
Experiment 8 Reporting the Activity Date of This ADC					[1]
Efficacy Data	Half Maximal inhibitory Concentration (lC50)	> 5 nM	High CD48 expression (CD48 +++)
Method Description	NY920-P1-L17-P4 was tested in MOLP-8
In Vitro Model	Plasma cell myeloma	MOLP-8 cells		CVCL_2124
Experiment 9 Reporting the Activity Date of This ADC					[1]
Efficacy Data	Half Maximal inhibitory Concentration (lC50)	23.6 nM	High CD48 expression (CD48 +++)
Method Description	NY920-P1-L17-P4 was tested in RL
In Vitro Model	Diffuse large B-cell lymphoma	RL cells		CVCL_1660

NY920-P1-L12-P3 [Investigative]

ADC Info

Revealed Based on the Cell Line Data

Click To Hide/Show 8 Activity Data Related to This Level

Experiment 1 Reporting the Activity Date of This ADC					[1]
Efficacy Data	Half Maximal inhibitory Concentration (lC50)	0.033 nM	High CD48 expression (CD48 +++)
Method Description	NY920-P1-L12-P3 was tested in KHM-1B
In Vitro Model	Plasma cell myeloma, Multiple myeloma	KHM-1B cells		CVCL_2972
Experiment 2 Reporting the Activity Date of This ADC					[1]
Efficacy Data	Half Maximal inhibitory Concentration (lC50)	0.174 nM	High CD48 expression (CD48 +++)
Method Description	NY920-P1-L12-P3 was tested in KMS-21-BM
In Vitro Model	Multiple myeloma	KMS-21-BM cells		CVCL_2991
Experiment 3 Reporting the Activity Date of This ADC					[1]
Efficacy Data	Half Maximal inhibitory Concentration (lC50)	0.185 nM	High CD48 expression (CD48 +++)
Method Description	NY920-P1-L12-P3 was tested in NCI-H929
In Vitro Model	Plasma cell myeloma	NCI-H929 cells		CVCL_1600
Experiment 4 Reporting the Activity Date of This ADC					[1]
Efficacy Data	Half Maximal inhibitory Concentration (lC50)	< 1 nM	High CD48 expression (CD48 +++)
Method Description	NY920-P1-L12-P3 was tested in KMS-27
In Vitro Model	Plasma cell myeloma, Multiple myeloma	KMS-27 cells		CVCL_2993
Experiment 5 Reporting the Activity Date of This ADC					[1]
Efficacy Data	Half Maximal inhibitory Concentration (lC50)	1.07 nM	High CD48 expression (CD48 +++)
Method Description	NY920-P1-L12-P3 was tested in AMO-1
In Vitro Model	Multiple myeloma, Plasma cell myeloma	AMO-1 cells		CVCL_1806
Experiment 6 Reporting the Activity Date of This ADC					[1]
Efficacy Data	Half Maximal inhibitory Concentration (lC50)	> 10 nM	High CD48 expression (CD48 +++)
Method Description	NY920-P1-L12-P3 was tested in MOLP-8
In Vitro Model	Plasma cell myeloma	MOLP-8 cells		CVCL_2124
Experiment 7 Reporting the Activity Date of This ADC					[1]
Efficacy Data	Half Maximal inhibitory Concentration (lC50)	> 50 nM	High CD48 expression (CD48 +++)
Method Description	NY920-P1-L12-P3 was tested in WSU-DLCL2
In Vitro Model	Diffuse large B-cell lymphoma	WSU-DLCL2 cells		CVCL_1902
Experiment 8 Reporting the Activity Date of This ADC					[1]
Efficacy Data	Half Maximal inhibitory Concentration (lC50)	221.8 nM	High CD48 expression (CD48 +++)
Method Description	NY920-P1-L12-P3 was tested in RL
In Vitro Model	Diffuse large B-cell lymphoma	RL cells		CVCL_1660

NY920-P1-L12-P2 [Investigative]

ADC Info

Revealed Based on the Cell Line Data

Click To Hide/Show 8 Activity Data Related to This Level

Experiment 1 Reporting the Activity Date of This ADC					[1]
Efficacy Data	Half Maximal inhibitory Concentration (lC50)	0.037 nM	High CD48 expression (CD48 +++)
Method Description	NY920-P1-L12-P2 was tested in KHM-1B
In Vitro Model	Plasma cell myeloma, Multiple myeloma	KHM-1B cells		CVCL_2972
Experiment 2 Reporting the Activity Date of This ADC					[1]
Efficacy Data	Half Maximal inhibitory Concentration (lC50)	0.217 nM	High CD48 expression (CD48 +++)
Method Description	NY920-P1-L12-P2 was tested in NCI-H929
In Vitro Model	Plasma cell myeloma	NCI-H929 cells		CVCL_1600
Experiment 3 Reporting the Activity Date of This ADC					[1]
Efficacy Data	Half Maximal inhibitory Concentration (lC50)	0.305 nM	High CD48 expression (CD48 +++)
Method Description	NY920-P1-L12-P2 was tested in KMS-27
In Vitro Model	Plasma cell myeloma, Multiple myeloma	KMS-27 cells		CVCL_2993
Experiment 4 Reporting the Activity Date of This ADC					[1]
Efficacy Data	Half Maximal inhibitory Concentration (lC50)	0.38 nM	High CD48 expression (CD48 +++)
Method Description	NY920-P1-L12-P2 was tested in KMS-21-BM
In Vitro Model	Multiple myeloma	KMS-21-BM cells		CVCL_2991
Experiment 5 Reporting the Activity Date of This ADC					[1]
Efficacy Data	Half Maximal inhibitory Concentration (lC50)	< 1 nM	High CD48 expression (CD48 +++)
Method Description	NY920-P1-L12-P2 was tested in Ke97
In Vitro Model	Bladder carcinoma	Ke97 cells		CVCL_3386
Experiment 6 Reporting the Activity Date of This ADC					[1]
Efficacy Data	Half Maximal inhibitory Concentration (lC50)	< 5 nM	High CD48 expression (CD48 +++)
Method Description	NY920-P1-L12-P2 was tested in AMO-1
In Vitro Model	Multiple myeloma, Plasma cell myeloma	AMO-1 cells		CVCL_1806
Experiment 7 Reporting the Activity Date of This ADC					[1]
Efficacy Data	Half Maximal inhibitory Concentration (lC50)	> 50 nM	High CD48 expression (CD48 +++)
Method Description	NY920-P1-L12-P2 was tested in WSU-DLCL2
In Vitro Model	Diffuse large B-cell lymphoma	WSU-DLCL2 cells		CVCL_1902
Experiment 8 Reporting the Activity Date of This ADC					[1]
Efficacy Data	Half Maximal inhibitory Concentration (lC50)	> 50 nM	High CD48 expression (CD48 +++)
Method Description	NY920-P1-L12-P2 was tested in MOLP-8
In Vitro Model	Plasma cell myeloma	MOLP-8 cells		CVCL_2124

NY920-P1-L19-P2 [Investigative]

ADC Info

Revealed Based on the Cell Line Data

Click To Hide/Show 8 Activity Data Related to This Level

Experiment 1 Reporting the Activity Date of This ADC					[1]
Efficacy Data	Half Maximal inhibitory Concentration (lC50)	0.037 nM	High CD48 expression (CD48 +++)
Method Description	NY920-P1-L19-P2 was tested in KHM-1B
In Vitro Model	Plasma cell myeloma, Multiple myeloma	KHM-1B cells		CVCL_2972
Experiment 2 Reporting the Activity Date of This ADC					[1]
Efficacy Data	Half Maximal inhibitory Concentration (lC50)	0.06 nM	High CD48 expression (CD48 +++)
Method Description	NY920-P1-L19-P2 was tested in NCI-H929
In Vitro Model	Plasma cell myeloma	NCI-H929 cells		CVCL_1600
Experiment 3 Reporting the Activity Date of This ADC					[1]
Efficacy Data	Half Maximal inhibitory Concentration (lC50)	0.146 nM	High CD48 expression (CD48 +++)
Method Description	NY920-P1-L19-P2 was tested in KMS-21-BM
In Vitro Model	Multiple myeloma	KMS-21-BM cells		CVCL_2991
Experiment 4 Reporting the Activity Date of This ADC					[1]
Efficacy Data	Half Maximal inhibitory Concentration (lC50)	0.16 nM	High CD48 expression (CD48 +++)
Method Description	NY920-P1-L19-P2 was tested in Ke97
In Vitro Model	Bladder carcinoma	Ke97 cells		CVCL_3386
Experiment 5 Reporting the Activity Date of This ADC					[1]
Efficacy Data	Half Maximal inhibitory Concentration (lC50)	0.216 nM	High CD48 expression (CD48 +++)
Method Description	NY920-P1-L19-P2 was tested in KMS-27
In Vitro Model	Plasma cell myeloma, Multiple myeloma	KMS-27 cells		CVCL_2993
Experiment 6 Reporting the Activity Date of This ADC					[1]
Efficacy Data	Half Maximal inhibitory Concentration (lC50)	0.407 nM	High CD48 expression (CD48 +++)
Method Description	NY920-P1-L19-P2 was tested in AMO-1
In Vitro Model	Multiple myeloma, Plasma cell myeloma	AMO-1 cells		CVCL_1806
Experiment 7 Reporting the Activity Date of This ADC					[1]
Efficacy Data	Half Maximal inhibitory Concentration (lC50)	> 10 nM	High CD48 expression (CD48 +++)
Method Description	NY920-P1-L19-P2 was tested in MOLP-8
In Vitro Model	Plasma cell myeloma	MOLP-8 cells		CVCL_2124
Experiment 8 Reporting the Activity Date of This ADC					[1]
Efficacy Data	Half Maximal inhibitory Concentration (lC50)	> 50 nM	High CD48 expression (CD48 +++)
Method Description	NY920-P1-L19-P2 was tested in WSU-DLCL2
In Vitro Model	Diffuse large B-cell lymphoma	WSU-DLCL2 cells		CVCL_1902

NY920-P1-L17-P3 [Investigative]

ADC Info

Revealed Based on the Cell Line Data

Click To Hide/Show 9 Activity Data Related to This Level

Experiment 1 Reporting the Activity Date of This ADC					[1]
Efficacy Data	Half Maximal inhibitory Concentration (lC50)	0.046 nM	High CD48 expression (CD48 +++)
Method Description	NY920-P1-L17-P3 was tested in KHM-1B
In Vitro Model	Plasma cell myeloma, Multiple myeloma	KHM-1B cells		CVCL_2972
Experiment 2 Reporting the Activity Date of This ADC					[1]
Efficacy Data	Half Maximal inhibitory Concentration (lC50)	0.121 nM	High CD48 expression (CD48 +++)
Method Description	NY920-P1-L17-P3 was tested in NCI-H929
In Vitro Model	Plasma cell myeloma	NCI-H929 cells		CVCL_1600
Experiment 3 Reporting the Activity Date of This ADC					[1]
Efficacy Data	Half Maximal inhibitory Concentration (lC50)	0.257 nM	High CD48 expression (CD48 +++)
Method Description	NY920-P1-L17-P3 was tested in KMS-27
In Vitro Model	Plasma cell myeloma, Multiple myeloma	KMS-27 cells		CVCL_2993
Experiment 4 Reporting the Activity Date of This ADC					[1]
Efficacy Data	Half Maximal inhibitory Concentration (lC50)	0.287 nM	High CD48 expression (CD48 +++)
Method Description	NY920-P1-L17-P3 was tested in Ke97
In Vitro Model	Bladder carcinoma	Ke97 cells		CVCL_3386
Experiment 5 Reporting the Activity Date of This ADC					[1]
Efficacy Data	Half Maximal inhibitory Concentration (lC50)	0.32 nM	High CD48 expression (CD48 +++)
Method Description	NY920-P1-L17-P3 was tested in KMS-21-BM
In Vitro Model	Multiple myeloma	KMS-21-BM cells		CVCL_2991
Experiment 6 Reporting the Activity Date of This ADC					[1]
Efficacy Data	Half Maximal inhibitory Concentration (lC50)	0.832 nM	High CD48 expression (CD48 +++)
Method Description	NY920-P1-L17-P3 was tested in AMO-1
In Vitro Model	Multiple myeloma, Plasma cell myeloma	AMO-1 cells		CVCL_1806
Experiment 7 Reporting the Activity Date of This ADC					[1]
Efficacy Data	Half Maximal inhibitory Concentration (lC50)	> 5 nM	High CD48 expression (CD48 +++)
Method Description	NY920-P1-L17-P3 was tested in MOLP-8
In Vitro Model	Plasma cell myeloma	MOLP-8 cells		CVCL_2124
Experiment 8 Reporting the Activity Date of This ADC					[1]
Efficacy Data	Half Maximal inhibitory Concentration (lC50)	> 50 nM	High CD48 expression (CD48 +++)
Method Description	NY920-P1-L17-P3 was tested in WSU-DLCL2
In Vitro Model	Diffuse large B-cell lymphoma	WSU-DLCL2 cells		CVCL_1902
Experiment 9 Reporting the Activity Date of This ADC					[1]
Efficacy Data	Half Maximal inhibitory Concentration (lC50)	> 250 nM	High CD48 expression (CD48 +++)
Method Description	NY920-P1-L17-P3 was tested in RL
In Vitro Model	Diffuse large B-cell lymphoma	RL cells		CVCL_1660

References

Ref 1	Antibody-drug conjugates of antineoplastic compounds and methods of use thereof

Antibody Information

Citation

Visitor Map

Correspondence

Prof. Feng ZHU (zhufeng@zju.edu.cn)

Prof. Xiaowu DONG (dongxw@zju.edu.cn)

Prof. Luo FANG (fangluo@zjcc.org.cn)