Antibody Information
General Information of This Antibody (ID: ANTI0TKAVC)
| Antibody Name | NY920 |
|||||
|---|---|---|---|---|---|---|
| Organization | z |
|||||
| Synonyms |
NY920
Click to Show/Hide
|
|||||
| Antibody Type | Monoclonal antibody (mAb) |
|||||
| Antibody Subtype | Humanized lgG |
|||||
| Antigen Name | CD48 antigen (CD48) |
Antigen Info | ||||
| Click to Show/Hide the Sequence Information of This Antibody | ||||||
| Heavy Chain Sequence |
EVOLLESGGGLVQPGGSLRLSCAASGFTFSSFAMSWVRQAPGKGLEWVSAISGFGGSTYY
ADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARQFWEDQPFYFDYWGQGTLVTVS SASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPCPVTVSWNSGALTSGVHTFPAVLQS SGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPKSCDKTHTCPPCPAPELLG GPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQY NSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRE EMTKNQVSLTCLVKGFYPCDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSR WQQGNVFSCSVMHEALHNHYTQKSLSLSPGK Click to Show/Hide
|
|||||
| Light Chain Sequence |
DIQMTQSPSSLSASVGDRVTITCRASQSISSYLNWYQQKPGKAPKLLIYAASSLQSGVPS
RFSGSGSGTDFTLTISSLOPEDFATYYCQQSYSTPLTFGQGTKVEIKRTVAAPSVFIFPP SDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLT LSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC Click to Show/Hide
|
|||||
Each Antibody-drug Conjugate Related to This Antibody
Full Information of The Activity Data of The ADC(s) Related to This Antibody
NY920-P1-L12-P4 [Investigative]
Revealed Based on the Cell Line Data
| Experiment 1 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Half Maximal inhibitory Concentration (lC50) |
0.011 nM
|
High CD48 expression (CD48 +++) | ||
| Method Description |
NY920-P1-L12-P4 was tested in KMS-27
|
||||
| In Vitro Model | Plasma cell myeloma, Multiple myeloma | KMS-27 cells | CVCL_2993 | ||
| Experiment 2 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Half Maximal inhibitory Concentration (lC50) |
0.027 nM
|
High CD48 expression (CD48 +++) | ||
| Method Description |
NY920-P1-L12-P4 was tested in Ke97
|
||||
| In Vitro Model | Bladder carcinoma | Ke97 cells | CVCL_3386 | ||
| Experiment 3 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Half Maximal inhibitory Concentration (lC50) |
0.036 nM
|
High CD48 expression (CD48 +++) | ||
| Method Description |
NY920-P1-L12-P4 was tested in KHM-1B
|
||||
| In Vitro Model | Plasma cell myeloma, Multiple myeloma | KHM-1B cells | CVCL_2972 | ||
| Experiment 4 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Half Maximal inhibitory Concentration (lC50) |
0.07 nM
|
High CD48 expression (CD48 +++) | ||
| Method Description |
NY920-P1-L12-P4 was tested in NCI-H929
|
||||
| In Vitro Model | Plasma cell myeloma | NCI-H929 cells | CVCL_1600 | ||
| Experiment 5 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Half Maximal inhibitory Concentration (lC50) |
0.254 nM
|
High CD48 expression (CD48 +++) | ||
| Method Description |
NY920-P1-L12-P4 was tested in KMS-21-BM
|
||||
| In Vitro Model | Multiple myeloma | KMS-21-BM cells | CVCL_2991 | ||
| Experiment 6 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Half Maximal inhibitory Concentration (lC50) |
0.531 nM
|
High CD48 expression (CD48 +++) | ||
| Method Description |
NY920-P1-L12-P4 was tested in AMO-1
|
||||
| In Vitro Model | Multiple myeloma, Plasma cell myeloma | AMO-1 cells | CVCL_1806 | ||
| Experiment 7 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Half Maximal inhibitory Concentration (lC50) | > 10 nM | High CD48 expression (CD48 +++) | ||
| Method Description |
NY920-P1-L12-P4 was tested in MOLP-8
|
||||
| In Vitro Model | Plasma cell myeloma | MOLP-8 cells | CVCL_2124 | ||
| Experiment 8 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Half Maximal inhibitory Concentration (lC50) |
19.67 nM
|
High CD48 expression (CD48 +++) | ||
| Method Description |
NY920-P1-L12-P4 was tested in RL
|
||||
| In Vitro Model | Diffuse large B-cell lymphoma | RL cells | CVCL_1660 | ||
| Experiment 9 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Half Maximal inhibitory Concentration (lC50) | < 50 nM | High CD48 expression (CD48 +++) | ||
| Method Description |
NY920-P1-L12-P4 was tested in WSU-DLCL2
|
||||
| In Vitro Model | Diffuse large B-cell lymphoma | WSU-DLCL2 cells | CVCL_1902 | ||
NY920-P1-L17-P4 [Investigative]
Revealed Based on the Cell Line Data
| Experiment 1 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Half Maximal inhibitory Concentration (lC50) |
0.031 nM
|
High CD48 expression (CD48 +++) | ||
| Method Description |
NY920-P1-L17-P4 was tested in KNM-1B
|
||||
| In Vitro Model | Plasma cell myeloma, Multiple myeloma | KHM-1B cells | CVCL_2972 | ||
| Experiment 2 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Half Maximal inhibitory Concentration (lC50) |
0.041 nM
|
High CD48 expression (CD48 +++) | ||
| Method Description |
NY920-P1-L17-P4 was tested in KMS-27
|
||||
| In Vitro Model | Plasma cell myeloma, Multiple myeloma | KMS-27 cells | CVCL_2993 | ||
| Experiment 3 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Half Maximal inhibitory Concentration (lC50) |
0.133 nM
|
High CD48 expression (CD48 +++) | ||
| Method Description |
NY920-P1-L17-P4 was tested in NCI-H929
|
||||
| In Vitro Model | Plasma cell myeloma | NCI-H929 cells | CVCL_1600 | ||
| Experiment 4 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Half Maximal inhibitory Concentration (lC50) |
0.33 nM
|
High CD48 expression (CD48 +++) | ||
| Method Description |
NY920-P1-L17-P4 was tested in KMS-21-BM
|
||||
| In Vitro Model | Multiple myeloma | KMS-21-BM cells | CVCL_2991 | ||
| Experiment 5 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Half Maximal inhibitory Concentration (lC50) |
1.11 nM
|
High CD48 expression (CD48 +++) | ||
| Method Description |
NY920-P1-L17-P4 was tested in Ke97
|
||||
| In Vitro Model | Bladder carcinoma | Ke97 cells | CVCL_3386 | ||
| Experiment 6 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Half Maximal inhibitory Concentration (lC50) |
1.48 nM
|
High CD48 expression (CD48 +++) | ||
| Method Description |
NY920-P1-L17-P4 was tested in WSU-DLCL2
|
||||
| In Vitro Model | Diffuse large B-cell lymphoma | WSU-DLCL2 cells | CVCL_1902 | ||
| Experiment 7 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Half Maximal inhibitory Concentration (lC50) |
1.49 nM
|
High CD48 expression (CD48 +++) | ||
| Method Description |
NY920-P1-L17-P4 was tested in AMO-1
|
||||
| In Vitro Model | Multiple myeloma, Plasma cell myeloma | AMO-1 cells | CVCL_1806 | ||
| Experiment 8 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Half Maximal inhibitory Concentration (lC50) | > 5 nM | High CD48 expression (CD48 +++) | ||
| Method Description |
NY920-P1-L17-P4 was tested in MOLP-8
|
||||
| In Vitro Model | Plasma cell myeloma | MOLP-8 cells | CVCL_2124 | ||
| Experiment 9 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Half Maximal inhibitory Concentration (lC50) |
23.6 nM
|
High CD48 expression (CD48 +++) | ||
| Method Description |
NY920-P1-L17-P4 was tested in RL
|
||||
| In Vitro Model | Diffuse large B-cell lymphoma | RL cells | CVCL_1660 | ||
NY920-P1-L12-P3 [Investigative]
Revealed Based on the Cell Line Data
| Experiment 1 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Half Maximal inhibitory Concentration (lC50) |
0.033 nM
|
High CD48 expression (CD48 +++) | ||
| Method Description |
NY920-P1-L12-P3 was tested in KHM-1B
|
||||
| In Vitro Model | Plasma cell myeloma, Multiple myeloma | KHM-1B cells | CVCL_2972 | ||
| Experiment 2 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Half Maximal inhibitory Concentration (lC50) |
0.174 nM
|
High CD48 expression (CD48 +++) | ||
| Method Description |
NY920-P1-L12-P3 was tested in KMS-21-BM
|
||||
| In Vitro Model | Multiple myeloma | KMS-21-BM cells | CVCL_2991 | ||
| Experiment 3 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Half Maximal inhibitory Concentration (lC50) |
0.185 nM
|
High CD48 expression (CD48 +++) | ||
| Method Description |
NY920-P1-L12-P3 was tested in NCI-H929
|
||||
| In Vitro Model | Plasma cell myeloma | NCI-H929 cells | CVCL_1600 | ||
| Experiment 4 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Half Maximal inhibitory Concentration (lC50) | < 1 nM | High CD48 expression (CD48 +++) | ||
| Method Description |
NY920-P1-L12-P3 was tested in KMS-27
|
||||
| In Vitro Model | Plasma cell myeloma, Multiple myeloma | KMS-27 cells | CVCL_2993 | ||
| Experiment 5 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Half Maximal inhibitory Concentration (lC50) |
1.07 nM
|
High CD48 expression (CD48 +++) | ||
| Method Description |
NY920-P1-L12-P3 was tested in AMO-1
|
||||
| In Vitro Model | Multiple myeloma, Plasma cell myeloma | AMO-1 cells | CVCL_1806 | ||
| Experiment 6 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Half Maximal inhibitory Concentration (lC50) | > 10 nM | High CD48 expression (CD48 +++) | ||
| Method Description |
NY920-P1-L12-P3 was tested in MOLP-8
|
||||
| In Vitro Model | Plasma cell myeloma | MOLP-8 cells | CVCL_2124 | ||
| Experiment 7 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Half Maximal inhibitory Concentration (lC50) | > 50 nM | High CD48 expression (CD48 +++) | ||
| Method Description |
NY920-P1-L12-P3 was tested in WSU-DLCL2
|
||||
| In Vitro Model | Diffuse large B-cell lymphoma | WSU-DLCL2 cells | CVCL_1902 | ||
| Experiment 8 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Half Maximal inhibitory Concentration (lC50) |
221.8 nM
|
High CD48 expression (CD48 +++) | ||
| Method Description |
NY920-P1-L12-P3 was tested in RL
|
||||
| In Vitro Model | Diffuse large B-cell lymphoma | RL cells | CVCL_1660 | ||
NY920-P1-L12-P2 [Investigative]
Revealed Based on the Cell Line Data
| Experiment 1 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Half Maximal inhibitory Concentration (lC50) |
0.037 nM
|
High CD48 expression (CD48 +++) | ||
| Method Description |
NY920-P1-L12-P2 was tested in KHM-1B
|
||||
| In Vitro Model | Plasma cell myeloma, Multiple myeloma | KHM-1B cells | CVCL_2972 | ||
| Experiment 2 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Half Maximal inhibitory Concentration (lC50) |
0.217 nM
|
High CD48 expression (CD48 +++) | ||
| Method Description |
NY920-P1-L12-P2 was tested in NCI-H929
|
||||
| In Vitro Model | Plasma cell myeloma | NCI-H929 cells | CVCL_1600 | ||
| Experiment 3 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Half Maximal inhibitory Concentration (lC50) |
0.305 nM
|
High CD48 expression (CD48 +++) | ||
| Method Description |
NY920-P1-L12-P2 was tested in KMS-27
|
||||
| In Vitro Model | Plasma cell myeloma, Multiple myeloma | KMS-27 cells | CVCL_2993 | ||
| Experiment 4 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Half Maximal inhibitory Concentration (lC50) |
0.38 nM
|
High CD48 expression (CD48 +++) | ||
| Method Description |
NY920-P1-L12-P2 was tested in KMS-21-BM
|
||||
| In Vitro Model | Multiple myeloma | KMS-21-BM cells | CVCL_2991 | ||
| Experiment 5 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Half Maximal inhibitory Concentration (lC50) | < 1 nM | High CD48 expression (CD48 +++) | ||
| Method Description |
NY920-P1-L12-P2 was tested in Ke97
|
||||
| In Vitro Model | Bladder carcinoma | Ke97 cells | CVCL_3386 | ||
| Experiment 6 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Half Maximal inhibitory Concentration (lC50) | < 5 nM | High CD48 expression (CD48 +++) | ||
| Method Description |
NY920-P1-L12-P2 was tested in AMO-1
|
||||
| In Vitro Model | Multiple myeloma, Plasma cell myeloma | AMO-1 cells | CVCL_1806 | ||
| Experiment 7 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Half Maximal inhibitory Concentration (lC50) | > 50 nM | High CD48 expression (CD48 +++) | ||
| Method Description |
NY920-P1-L12-P2 was tested in WSU-DLCL2
|
||||
| In Vitro Model | Diffuse large B-cell lymphoma | WSU-DLCL2 cells | CVCL_1902 | ||
| Experiment 8 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Half Maximal inhibitory Concentration (lC50) | > 50 nM | High CD48 expression (CD48 +++) | ||
| Method Description |
NY920-P1-L12-P2 was tested in MOLP-8
|
||||
| In Vitro Model | Plasma cell myeloma | MOLP-8 cells | CVCL_2124 | ||
NY920-P1-L19-P2 [Investigative]
Revealed Based on the Cell Line Data
| Experiment 1 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Half Maximal inhibitory Concentration (lC50) |
0.037 nM
|
High CD48 expression (CD48 +++) | ||
| Method Description |
NY920-P1-L19-P2 was tested in KHM-1B
|
||||
| In Vitro Model | Plasma cell myeloma, Multiple myeloma | KHM-1B cells | CVCL_2972 | ||
| Experiment 2 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Half Maximal inhibitory Concentration (lC50) |
0.06 nM
|
High CD48 expression (CD48 +++) | ||
| Method Description |
NY920-P1-L19-P2 was tested in NCI-H929
|
||||
| In Vitro Model | Plasma cell myeloma | NCI-H929 cells | CVCL_1600 | ||
| Experiment 3 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Half Maximal inhibitory Concentration (lC50) |
0.146 nM
|
High CD48 expression (CD48 +++) | ||
| Method Description |
NY920-P1-L19-P2 was tested in KMS-21-BM
|
||||
| In Vitro Model | Multiple myeloma | KMS-21-BM cells | CVCL_2991 | ||
| Experiment 4 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Half Maximal inhibitory Concentration (lC50) |
0.16 nM
|
High CD48 expression (CD48 +++) | ||
| Method Description |
NY920-P1-L19-P2 was tested in Ke97
|
||||
| In Vitro Model | Bladder carcinoma | Ke97 cells | CVCL_3386 | ||
| Experiment 5 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Half Maximal inhibitory Concentration (lC50) |
0.216 nM
|
High CD48 expression (CD48 +++) | ||
| Method Description |
NY920-P1-L19-P2 was tested in KMS-27
|
||||
| In Vitro Model | Plasma cell myeloma, Multiple myeloma | KMS-27 cells | CVCL_2993 | ||
| Experiment 6 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Half Maximal inhibitory Concentration (lC50) |
0.407 nM
|
High CD48 expression (CD48 +++) | ||
| Method Description |
NY920-P1-L19-P2 was tested in AMO-1
|
||||
| In Vitro Model | Multiple myeloma, Plasma cell myeloma | AMO-1 cells | CVCL_1806 | ||
| Experiment 7 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Half Maximal inhibitory Concentration (lC50) | > 10 nM | High CD48 expression (CD48 +++) | ||
| Method Description |
NY920-P1-L19-P2 was tested in MOLP-8
|
||||
| In Vitro Model | Plasma cell myeloma | MOLP-8 cells | CVCL_2124 | ||
| Experiment 8 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Half Maximal inhibitory Concentration (lC50) | > 50 nM | High CD48 expression (CD48 +++) | ||
| Method Description |
NY920-P1-L19-P2 was tested in WSU-DLCL2
|
||||
| In Vitro Model | Diffuse large B-cell lymphoma | WSU-DLCL2 cells | CVCL_1902 | ||
NY920-P1-L17-P3 [Investigative]
Revealed Based on the Cell Line Data
| Experiment 1 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Half Maximal inhibitory Concentration (lC50) |
0.046 nM
|
High CD48 expression (CD48 +++) | ||
| Method Description |
NY920-P1-L17-P3 was tested in KHM-1B
|
||||
| In Vitro Model | Plasma cell myeloma, Multiple myeloma | KHM-1B cells | CVCL_2972 | ||
| Experiment 2 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Half Maximal inhibitory Concentration (lC50) |
0.121 nM
|
High CD48 expression (CD48 +++) | ||
| Method Description |
NY920-P1-L17-P3 was tested in NCI-H929
|
||||
| In Vitro Model | Plasma cell myeloma | NCI-H929 cells | CVCL_1600 | ||
| Experiment 3 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Half Maximal inhibitory Concentration (lC50) |
0.257 nM
|
High CD48 expression (CD48 +++) | ||
| Method Description |
NY920-P1-L17-P3 was tested in KMS-27
|
||||
| In Vitro Model | Plasma cell myeloma, Multiple myeloma | KMS-27 cells | CVCL_2993 | ||
| Experiment 4 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Half Maximal inhibitory Concentration (lC50) |
0.287 nM
|
High CD48 expression (CD48 +++) | ||
| Method Description |
NY920-P1-L17-P3 was tested in Ke97
|
||||
| In Vitro Model | Bladder carcinoma | Ke97 cells | CVCL_3386 | ||
| Experiment 5 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Half Maximal inhibitory Concentration (lC50) |
0.32 nM
|
High CD48 expression (CD48 +++) | ||
| Method Description |
NY920-P1-L17-P3 was tested in KMS-21-BM
|
||||
| In Vitro Model | Multiple myeloma | KMS-21-BM cells | CVCL_2991 | ||
| Experiment 6 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Half Maximal inhibitory Concentration (lC50) |
0.832 nM
|
High CD48 expression (CD48 +++) | ||
| Method Description |
NY920-P1-L17-P3 was tested in AMO-1
|
||||
| In Vitro Model | Multiple myeloma, Plasma cell myeloma | AMO-1 cells | CVCL_1806 | ||
| Experiment 7 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Half Maximal inhibitory Concentration (lC50) | > 5 nM | High CD48 expression (CD48 +++) | ||
| Method Description |
NY920-P1-L17-P3 was tested in MOLP-8
|
||||
| In Vitro Model | Plasma cell myeloma | MOLP-8 cells | CVCL_2124 | ||
| Experiment 8 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Half Maximal inhibitory Concentration (lC50) | > 50 nM | High CD48 expression (CD48 +++) | ||
| Method Description |
NY920-P1-L17-P3 was tested in WSU-DLCL2
|
||||
| In Vitro Model | Diffuse large B-cell lymphoma | WSU-DLCL2 cells | CVCL_1902 | ||
| Experiment 9 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Half Maximal inhibitory Concentration (lC50) | > 250 nM | High CD48 expression (CD48 +++) | ||
| Method Description |
NY920-P1-L17-P3 was tested in RL
|
||||
| In Vitro Model | Diffuse large B-cell lymphoma | RL cells | CVCL_1660 | ||
