General Information of This Antibody (ID: ANTI0ROEFH)
Antibody Name
P0
Organization
EXELIXIS, INC.
Synonyms
P0
   Click to Show/Hide
Antibody Type
Bispecific antibody (BsAb)
Antibody Subtype
Humanized lgG
Antigen Name
Inactive tyrosine-protein kinase transmembrane receptor ROR1 (ROR1); Tyrosine-protein kinase transmembrane receptor ROR2 (ROR2)
 Antigen Info 
Click to Show/Hide the Sequence Information of This Antibody
Heavy Chain Sequence
EVQLVESGGGLVQPGGSLRLSCAASGFTFSSYFIHWVRQAPGKGLEWVAGIYPSEGYTSY
ADSVKGRFTISADTSKNTAYLQMNSLRAEDTAVYYCARYYVSGMDYWGQGTLVTVSSAST
KGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLY
SLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSV
FLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTY
RVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTK
NQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQG
NVFSCSVMHEALHNHYTQKSLSLSPGK
    Click to Show/Hide
Light Chain Sequence
DIQMTQSPSSLSASVGDRVTITCRASQSVSSAVAWYQQKPGKAPKLLIYSASSLQSGVPS
RFSGSRSGTDFTLTISSLQPEDFATYYCQQYYYYPGTFGQGTKVEIKRTVAAPSVFIFPP
SDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLT
LSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC
    Click to Show/Hide
Each Antibody-drug Conjugate Related to This Antibody
Full Information of The Activity Data of The ADC(s) Related to This Antibody
WO2025019776A2ADC-00 [Investigative]
Discovered Using Cell Line-derived Xenograft Model
Click To Hide/Show 2 Activity Data Related to This Level
Experiment 1 Reporting the Activity Date of This ADC [1]
Efficacy Data Tumor Growth lnhibition value (TGl) > 30% Positive ROR1 expression (ROR1+++/++)
Method Description
CB.17 female SCID mice were inoculated subcutaneously in the right up flank region with Jeko-1 tumor cells (5×10 6)in 0.1 mL of PBS with Matrigel (1:1)for tumor development.When the tumor volumes reached about 150~250 mm 3on Day 1,mice were randomized into respective treatment groups (8 mice per group).The mice then received intravenous injections of vehicle or the tested ADC-00 at 7.5mg/kg on Day 1 and Day 8.PBS vehicle was tested in parallel,serving as a control.

   Click to Show/Hide
In Vivo Model JEKO-1 MCL Xenograft Model
Experiment 2 Reporting the Activity Date of This ADC [1]
Efficacy Data Tumor Growth lnhibition value (TGl) > 50% Positive ROR1 expression (ROR1+++/++)
Method Description
CB.17 female SCID mice were implanted (flank)with 1.0x10 7of MDA-MB-231 tumor cells in 50%MATRIGELR (Corning Life Sciences)matrix (1:1 cell to Matrigel) on Day -13.When the average tumor volume reached about 200 mm 3on Day 1,mice were randomized into respective treatment groups (10 mice per group).The mice then received intravenous injections of the tested ADC-00 at 7.5 mg/kg on Day 1 and Day 8.PBS vehicle was tested in parallel,serving as a control.Body weight and tumor volume were measured twice per week.The study was ended on Day 45.

   Click to Show/Hide
In Vivo Model MDA-MB-231 TNBC Xenograft Model
Revealed Based on the Cell Line Data
Click To Hide/Show 1 Activity Data Related to This Level
Experiment 1 Reporting the Activity Date of This ADC [1]
Efficacy Data Half Maximal inhibitory Concentration (lC50)
0.1-1 nM
Positive ROR1 expression (ROR1+++/++)
Method Description
In vitro cytotoxicity of the ADC-00 was assessed on hROR1 expressing HEK cells with a top concentration of 10 nM, and ADC-00 was serially diluted 1:4, The treated cells were incubated for 5 days.The cell viability reading was taken. In order to activate the masked ADCs,an enzyme digestion system MMP9 was added.
In Vitro Model Endocervical adenocarcinoma HEK cells CVCL_M624
References
Ref 1 Activatable tyrosine-protein kinase membrane receptor (ROR) antibody-drug conjugates and uses thereof