Antibody Information
General Information of This Antibody
| Antibody ID | ANI0UVJHQ |
|||||
|---|---|---|---|---|---|---|
| Antibody Name | huDS6v1.01 |
|||||
| Antibody Type | Monoclonal antibody (mAb) |
|||||
| Antibody Subtype | Humanized IgG1 |
|||||
| Antigen Name | CA6 sialoglycotope (CA6 glycotope) |
Antigen Info | ||||
| Click to Show/Hide the Sequence Information of This Antibody | ||||||
| Heavy Chain Sequence |
QAQLVQSGAEVVKPGASVKMSCKASGYTFTSYNMHWVKQTPGQGLEWIGYIYPGNGATNY
NQKFQGKATLTADTSSSTAYMQISSLTSEDSAVYFCARGDSVPFAYWGQGTLVTVSAC Click to Show/Hide
|
|||||
| Light Chain Sequence |
EIVLTQSPATMSASPGERVTILCSAHSSVSFMHWPQQKPGTSPKLWIYSTSSLASGVPAR
FGGSGSGTSYSLTISSMEAEDAATYYCQQRSSFPLTFGAGTKLELKR Click to Show/Hide
|
|||||
Each Antibody-drug Conjugate Related to This Antibody
Full Information of The Activity Data of The ADC(s) Related to This Antibody
huDS6v1.01-DM4 [Investigative]
Discovered Using Cell Line-derived Xenograft Model
| Experiment 1 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Tumor Growth Inhibition value (TGI) | ≈ 100.00% (Day 37) | Positive CA6 expression (CA6 +++/++) | ||
| Method Description |
The in vivo activity of huDS6v1.01-DM4 was tested onthe HPAC pancreatic model.HPAC cells were inoculated on Day 0, and immunoconjugate treatments were given on day13 (20 ug/kg). PBS control animals were euthanized once tumor vol-umes exceeded 1000 mm3.
|
||||
| In Vivo Model | HPAC CDX model | ||||
| In Vitro Model | Pancreatic adenocarcinoma | HPAC cells | CVCL_3517 | ||
Revealed Based on the Cell Line Data
| Experiment 1 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Half Maximal Inhibitory Concentration (IC50) | < 10.00 nM | Positive CA6 expression (CA6 +++/++) | ||
| Method Description |
In the MTT assay, cells were seeded in 96-well plates ata density of 1000-5000 cells/well. The cells were plated with serial dilutions of huDS6v1.01-DM4 immunoconjugate in 200 pl of culture media. The cells and antibody/conjugate mixtures were then incubated for 2-7 d, at which time cellviability was assessed by an MTT assay.
|
||||
| In Vitro Model | Human papillomavirus-related endocervical adenocarcinoma | KB cells | CVCL_0372 | ||
References
If you find any error in data or bug in web service, please kindly report it to Dr. Shen et al.