Antibody Information

General Information of This Antibody
Antibody ID
ANI0UBMKD
Antibody Name
AXL antibody YW327.6S2
Antibody Type
Monoclonal antibody (mAb)
Antibody Subtype
Humanized IgG1-kappa
Antigen Name
Tyrosine-protein kinase receptor UFO (AXL)
  Antigen Info 
Click to Show/Hide the Sequence Information of This Antibody
Heavy Chain Sequence
QVQLVQSGAEVKKPGASVKVSCKASGYPFTDFYINWVRQAPGQGLEWMGWIYPGSGNTKY
NEKFKGRVTLTVDTSISTAYMELSRLRSDDTAVYYCARSTGFFDYWGQGTLVTVSS
    Click to Show/Hide
Light Chain Sequence
EIVLTQSPATLSLSPGERATLSCSASSSIGYMYWYQQKPGQAPRLLIYLTSNLASGIPAR
FSGSGSGTDFTLTISSLEPEDFAVYYCQQWSSNPPTFGQGTKLEIK
    Click to Show/Hide
Each Antibody-drug Conjugate Related to This Antibody
Full Information of The Activity Data of The ADC(s) Related to This Antibody
AXL02 [Investigative]
 ADC Info 
Discovered Using Cell Line-derived Xenograft Model
Click To Hide/Show 4 Activity Data Related to This Level
Experiment 1 Reporting the Activity Date of This ADC [1]
Efficacy Data Tumor Growth Inhibition value (TGI) ≈ 96.10% (Day 35) High AXL expression (AXL+++)
Method Description
Cells were suspended in PBS then injected subcutaneously to the flank of Balb/c female nude mice (46 weeks old). Tumors were measured by caliper every 23 days. Before therapeutic treatment,tumor-bearing mice were staged at initial tumor volume of 100 to 300 mm3 (growth) or 1800 mm3 (regression) and randomized into treatment groups(n = 8). The ADCs were dosed i.v. once weekly,or total twice during entire study.

   Click to Show/Hide
In Vivo Model Lung cancer CDX model
In Vitro Model Lung adenocarcinoma PC-9 cells CVCL_B260
Experiment 2 Reporting the Activity Date of This ADC [1]
Efficacy Data Tumor Growth Inhibition value (TGI) ≈ 96.70% (Day 35) High AXL expression (AXL+++)
Method Description
Cells were suspended in PBS then injected subcutaneously to the flank of Balb/c female nude mice (46 weeks old). Tumors were measured by caliper every 23 days. Before therapeutic treatment,tumor-bearing mice were staged at initial tumor volume of 100 to 300 mm3 (growth) or 1800 mm3 (regression) and randomized into treatment groups(n = 8). The ADCs were dosed i.v. once weekly,or total twice during entire study.

   Click to Show/Hide
In Vivo Model Non-small cell lung cancer CDX model
In Vitro Model Lung large cell carcinoma NCI-H1299 cells CVCL_0060
Experiment 3 Reporting the Activity Date of This ADC [1]
Efficacy Data Tumor Growth Inhibition value (TGI) ≈ 98.70% (Day 35) High AXL expression (AXL+++)
Method Description
Cells were suspended in PBS then injected subcutaneously to the flank of Balb/c female nude mice (46 weeks old). Tumors were measured by caliper every 23 days. Before therapeutic treatment,tumor-bearing mice were staged at initial tumor volume of 100 to 300 mm3 (growth) or 1800 mm3 (regression) and randomized into treatment groups(n = 8). The ADCs were dosed i.v. once weekly,or total twice during entire study.

   Click to Show/Hide
In Vivo Model Lung cancer CDX model
In Vitro Model Lung large cell carcinoma LCLC-103H cells CVCL_1375
Experiment 4 Reporting the Activity Date of This ADC [1]
Efficacy Data Tumor Growth Inhibition value (TGI) ≈ 99.50% (Day 32) High AXL expression (AXL+++)
Method Description
Cells were suspended in PBS then injected subcutaneously to the flank of Balb/c female nude mice (46 weeks old). Tumors were measured by caliper every 23 days. Before therapeutic treatment,tumor-bearing mice were staged at initial tumor volume of 100 to 300 mm3 (growth) or 1800 mm3 (regression) and randomized into treatment groups(n = 8). The ADCs were dosed i.v. once weekly,or total twice during entire study.

   Click to Show/Hide
In Vivo Model Astrocytic glioblastoma CDX model
In Vitro Model Glioblastoma U-87MG cells CVCL_0022
References
Ref 1 AXL antibody and AXL-ADC mediate antitumor efficacy via targeting AXL in tumor-intrinsic epithelial-mesenchymal transition and tumor-associated M2-like macrophage. Acta Pharmacol Sin. 2023 Jun;44(6):1290-1303.

If you find any error in data or bug in web service, please kindly report it to Dr. Shen et al.