Antibody Information
General Information of This Antibody
| Antibody ID | ANI0UBMKD |
|||||
|---|---|---|---|---|---|---|
| Antibody Name | AXL antibody YW327.6S2 |
|||||
| Antibody Type | Monoclonal antibody (mAb) |
|||||
| Antibody Subtype | Humanized IgG1-kappa |
|||||
| Antigen Name | Tyrosine-protein kinase receptor UFO (AXL) |
Antigen Info | ||||
| Click to Show/Hide the Sequence Information of This Antibody | ||||||
| Heavy Chain Sequence |
QVQLVQSGAEVKKPGASVKVSCKASGYPFTDFYINWVRQAPGQGLEWMGWIYPGSGNTKY
NEKFKGRVTLTVDTSISTAYMELSRLRSDDTAVYYCARSTGFFDYWGQGTLVTVSS Click to Show/Hide
|
|||||
| Light Chain Sequence |
EIVLTQSPATLSLSPGERATLSCSASSSIGYMYWYQQKPGQAPRLLIYLTSNLASGIPAR
FSGSGSGTDFTLTISSLEPEDFAVYYCQQWSSNPPTFGQGTKLEIK Click to Show/Hide
|
|||||
Each Antibody-drug Conjugate Related to This Antibody
Full Information of The Activity Data of The ADC(s) Related to This Antibody
AXL02 [Investigative]
Discovered Using Cell Line-derived Xenograft Model
| Experiment 1 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Tumor Growth Inhibition value (TGI) | ≈ 96.10% (Day 35) | High AXL expression (AXL+++) | ||
| Method Description |
Cells were suspended in PBS then injected subcutaneously to the flank of Balb/c female nude mice (46 weeks old). Tumors were measured by caliper every 23 days. Before therapeutic treatment,tumor-bearing mice were staged at initial tumor volume of 100 to 300 mm3 (growth) or 1800 mm3 (regression) and randomized into treatment groups(n = 8). The ADCs were dosed i.v. once weekly,or total twice during entire study.
Click to Show/Hide
|
||||
| In Vivo Model | Lung cancer CDX model | ||||
| In Vitro Model | Lung adenocarcinoma | PC-9 cells | CVCL_B260 | ||
| Experiment 2 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Tumor Growth Inhibition value (TGI) | ≈ 96.70% (Day 35) | High AXL expression (AXL+++) | ||
| Method Description |
Cells were suspended in PBS then injected subcutaneously to the flank of Balb/c female nude mice (46 weeks old). Tumors were measured by caliper every 23 days. Before therapeutic treatment,tumor-bearing mice were staged at initial tumor volume of 100 to 300 mm3 (growth) or 1800 mm3 (regression) and randomized into treatment groups(n = 8). The ADCs were dosed i.v. once weekly,or total twice during entire study.
Click to Show/Hide
|
||||
| In Vivo Model | Non-small cell lung cancer CDX model | ||||
| In Vitro Model | Lung large cell carcinoma | NCI-H1299 cells | CVCL_0060 | ||
| Experiment 3 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Tumor Growth Inhibition value (TGI) | ≈ 98.70% (Day 35) | High AXL expression (AXL+++) | ||
| Method Description |
Cells were suspended in PBS then injected subcutaneously to the flank of Balb/c female nude mice (46 weeks old). Tumors were measured by caliper every 23 days. Before therapeutic treatment,tumor-bearing mice were staged at initial tumor volume of 100 to 300 mm3 (growth) or 1800 mm3 (regression) and randomized into treatment groups(n = 8). The ADCs were dosed i.v. once weekly,or total twice during entire study.
Click to Show/Hide
|
||||
| In Vivo Model | Lung cancer CDX model | ||||
| In Vitro Model | Lung large cell carcinoma | LCLC-103H cells | CVCL_1375 | ||
| Experiment 4 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Tumor Growth Inhibition value (TGI) | ≈ 99.50% (Day 32) | High AXL expression (AXL+++) | ||
| Method Description |
Cells were suspended in PBS then injected subcutaneously to the flank of Balb/c female nude mice (46 weeks old). Tumors were measured by caliper every 23 days. Before therapeutic treatment,tumor-bearing mice were staged at initial tumor volume of 100 to 300 mm3 (growth) or 1800 mm3 (regression) and randomized into treatment groups(n = 8). The ADCs were dosed i.v. once weekly,or total twice during entire study.
Click to Show/Hide
|
||||
| In Vivo Model | Astrocytic glioblastoma CDX model | ||||
| In Vitro Model | Glioblastoma | U-87MG cells | CVCL_0022 | ||
References
If you find any error in data or bug in web service, please kindly report it to Dr. Shen et al.
