General Information of This Antibody (ID: ANI0QYT008)
Antibody Name
Tilatamig
Organization
AstraZeneca PLC
Synonyms
Tilatamig
   Click to Show/Hide
Antibody Type
Bispecific antibody (BsAb)
Antigen Name
Epidermal growth factor receptor (EGFR); Hepatocyte growth factor receptor (MET)
 Antigen Info 
Click to Show/Hide the Sequence Information of This Antibody
Heavy Chain Sequence
QVQLVQSGAEVKKPGASVKVSCKASGYTFTDYYIHWVRQATGQGLEWMGWMNPNSGNTGY
AQKFQGRVTMTRDTSISTAYMELSSLRSEDTAVYYCARGQGYTHSWGQGTMVTVSS
    Click to Show/Hide
Light Chain Sequence
DIQMTQSPSTLSASVGDRVTITCRASEGIYHWLAWYQQKPGKAPKLLIYKASSLASGVPS
RFSGSGSGTEFTLTISSLQPDDFATYYCQQYSNYPPTFGGGTKLEIK
    Click to Show/Hide
Each Antibody-drug Conjugate Related to This Antibody
Full Information of The Activity Data of The ADC(s) Related to This Antibody
Tilatamig samrotecan [Phase 2]
Identified from the Human Clinical Data
Click To Hide/Show 3 Activity Data Related to This Level
Experiment 1 Reporting the Activity Date of This ADC [1]
Patients Enrolled
Eligible patients (≥18 years, ECOG 0-1) require measurable disease (RECIST v1.1), adequate organ function, and module-specific histology confirmation (EGFRmut NSCLC/HNSCC/CRC). Key exclusions include active ILD, untreated CNS metastases, uncontrolled infections, or significant cardiac comorbidities.
Related Clinical Trial
NCT Number NCT05647122  Clinical Status PHASE1
Clinical Description
A Phase I, Multicenter, Open-label, First-in-Human, Dose Escalation and Expansion Study of AZD9592 as Monotherapy and in Combination With Anti-cancer Agents in Patients With Advanced Solid Tumors
Primary Endpoint
Primary endpoints include AE/SAE incidence (monitored from consent to 30 days post-treatment), DLT assessment during first 21 days, lab/ECG/vital sign changes, and ORR (RECIST v1.1) in expansion cohorts over ~2 years.
Other Endpoint
Secondary endpoints comprise efficacy measures (ORR/DOR/DCR/PFS/OS) assessed via RECIST v1.1 over ~2 years, comprehensive PK analysis (AUC/Cmax/Tmax/clearance/half-life), and ADA immunogenicity evaluation until 30 days post-treatment.
Experiment 2 Reporting the Activity Date of This ADC [2]
Patients Enrolled
Eligible patients (&ge;18 years, ECOG 0-2) require confirmed HNSCC (oropharynx/hypopharynx/oral cavity/larynx) with injectable lesions meeting viability criteria. Key exclusions: insufficient tumor volume, critical structure proximity, prior immune/ADC therapy (last 5 years), pregnancy/lactation, uncontrolled comorbidities, or recent major surgery (<4 weeks). Contraception required for 7 months post-procedure.

   Click to Show/Hide
Related Clinical Trial
NCT Number NCT06366451  Clinical Status EARLY_PHASE1
Clinical Description
A Phase 0 Multicenter Study of the Pharmacodynamic Effects of Intratumoral Microdose Administration of Rilvegostomig, Volrustomig, Sabestomig, and AZD9592
Primary Endpoint
The primary objective involves spatial transcriptomic analysis (NanoString GeoMx DSP) of tumor microenvironments 1-3 days post-microdose injection of rilvegostomig, volrustomig, sabestomig, AZD9592, or pembrolizumab (mono/combination therapy), evaluating 1800+ genes with potential IHC/ISH validation.
Other Endpoint
Safety monitoring includes AE/ADE assessment (frequency, severity, causality) for 28 days post-microdose procedure in HNSCC patients with surgically accessible lesions (primary/recurrent/metastatic).
Experiment 3 Reporting the Activity Date of This ADC [3]
Patients Enrolled
Patients with metastatic non-small cell lung cancer (mNSCLC) with EGFRm (sensitizing L858R mutation or exon 19 deletions) or EGFR wild-type, or recurrent or metastatic head and neck squamous cell carcinoma (HNSCC).
Related Clinical Trial
NCT Number NCT05647122  Clinical Status Phase 1
Clinical Description
A phase 1, multicenter, open-label, first-in-human, dose escalation and expansion study of AZD9592 as monotherapy and in combination with anti-cancer agents in patients with advanced solid tumors.
References
Ref 1 First in Human Study of AZD9592 in Solid Tumors
Ref 2 PBI-MST-01 (NCT04541108) Substudy AZN-05: Intratumoral Microdosing of Rilvegostomig, Volrustomig, Sabestomig, and AZD9592 in HNSCC
Ref 3 A first-in-human study of the novel antibody-drug conjugate (ADC) AZD9592 as monotherapy or combined with other anticancer agents in patients (pts) with advanced solid tumors. J Clin Oncol. 2023 41:16_suppl, TPS3156-TPS3156.