Antibody Information
General Information of This Antibody (ID: ANI0QYT008)
| Antibody Name | Tilatamig |
|||||
|---|---|---|---|---|---|---|
| Organization | AstraZeneca PLC |
|||||
| Synonyms |
Tilatamig
Click to Show/Hide
|
|||||
| Antibody Type | Bispecific antibody (BsAb) |
|||||
| Antigen Name | Epidermal growth factor receptor (EGFR); Hepatocyte growth factor receptor (MET) |
Antigen Info | ||||
| Click to Show/Hide the Sequence Information of This Antibody | ||||||
| Heavy Chain Sequence |
QVQLVQSGAEVKKPGASVKVSCKASGYTFTDYYIHWVRQATGQGLEWMGWMNPNSGNTGY
AQKFQGRVTMTRDTSISTAYMELSSLRSEDTAVYYCARGQGYTHSWGQGTMVTVSS Click to Show/Hide
|
|||||
| Light Chain Sequence |
DIQMTQSPSTLSASVGDRVTITCRASEGIYHWLAWYQQKPGKAPKLLIYKASSLASGVPS
RFSGSGSGTEFTLTISSLQPDDFATYYCQQYSNYPPTFGGGTKLEIK Click to Show/Hide
|
|||||
Each Antibody-drug Conjugate Related to This Antibody
Full Information of The Activity Data of The ADC(s) Related to This Antibody
Tilatamig samrotecan [Phase 2]
Identified from the Human Clinical Data
| Experiment 1 Reporting the Activity Date of This ADC | [1] | ||||
| Patients Enrolled |
Eligible patients (≥18 years, ECOG 0-1) require measurable disease (RECIST v1.1), adequate organ function, and module-specific histology confirmation (EGFRmut NSCLC/HNSCC/CRC). Key exclusions include active ILD, untreated CNS metastases, uncontrolled infections, or significant cardiac comorbidities.
|
||||
| Related Clinical Trial | |||||
| NCT Number | NCT05647122 | Clinical Status | PHASE1 | ||
| Clinical Description |
A Phase I, Multicenter, Open-label, First-in-Human, Dose Escalation and Expansion Study of AZD9592 as Monotherapy and in Combination With Anti-cancer Agents in Patients With Advanced Solid Tumors
|
||||
| Primary Endpoint |
Primary endpoints include AE/SAE incidence (monitored from consent to 30 days post-treatment), DLT assessment during first 21 days, lab/ECG/vital sign changes, and ORR (RECIST v1.1) in expansion cohorts over ~2 years.
|
||||
| Other Endpoint |
Secondary endpoints comprise efficacy measures (ORR/DOR/DCR/PFS/OS) assessed via RECIST v1.1 over ~2 years, comprehensive PK analysis (AUC/Cmax/Tmax/clearance/half-life), and ADA immunogenicity evaluation until 30 days post-treatment.
|
||||
| Experiment 2 Reporting the Activity Date of This ADC | [2] | ||||
| Patients Enrolled |
Eligible patients (≥18 years, ECOG 0-2) require confirmed HNSCC (oropharynx/hypopharynx/oral cavity/larynx) with injectable lesions meeting viability criteria. Key exclusions: insufficient tumor volume, critical structure proximity, prior immune/ADC therapy (last 5 years), pregnancy/lactation, uncontrolled comorbidities, or recent major surgery (<4 weeks). Contraception required for 7 months post-procedure.
Click to Show/Hide
|
||||
| Related Clinical Trial | |||||
| NCT Number | NCT06366451 | Clinical Status | EARLY_PHASE1 | ||
| Clinical Description |
A Phase 0 Multicenter Study of the Pharmacodynamic Effects of Intratumoral Microdose Administration of Rilvegostomig, Volrustomig, Sabestomig, and AZD9592
|
||||
| Primary Endpoint |
The primary objective involves spatial transcriptomic analysis (NanoString GeoMx DSP) of tumor microenvironments 1-3 days post-microdose injection of rilvegostomig, volrustomig, sabestomig, AZD9592, or pembrolizumab (mono/combination therapy), evaluating 1800+ genes with potential IHC/ISH validation.
|
||||
| Other Endpoint |
Safety monitoring includes AE/ADE assessment (frequency, severity, causality) for 28 days post-microdose procedure in HNSCC patients with surgically accessible lesions (primary/recurrent/metastatic).
|
||||
| Experiment 3 Reporting the Activity Date of This ADC | [3] | ||||
| Patients Enrolled |
Patients with metastatic non-small cell lung cancer (mNSCLC) with EGFRm (sensitizing L858R mutation or exon 19 deletions) or EGFR wild-type, or recurrent or metastatic head and neck squamous cell carcinoma (HNSCC).
|
||||
| Related Clinical Trial | |||||
| NCT Number | NCT05647122 | Clinical Status | Phase 1 | ||
| Clinical Description |
A phase 1, multicenter, open-label, first-in-human, dose escalation and expansion study of AZD9592 as monotherapy and in combination with anti-cancer agents in patients with advanced solid tumors.
|
||||
References
