General Information of This Antibody (ID: ANI0PWRSL)
Antibody Name
SC17
Antibody Type
Monoclonal antibody (mAb)
Antibody Subtype
Humanized IgG1-kappa
Antigen Name
Seizure protein 6 homolog (SEZ6)
 Antigen Info 
Click to Show/Hide the Sequence Information of This Antibody
Heavy Chain Sequence
EVQLVQSGAEVKICPGESLKISCKGSGYSFTSSWINWVRQMPGKGLEWMGRIYPGEGDTN
YNGNFEGQVTISADKSISTAYLQWSSLKASDTAMYYCTRGLVMDYWGQGTLVTVSSASTK
GPSVFPLAPSSKSTSGGTAALGCLVICDYFPEPVTVSWNSGALTSGVH1TFPAVLQSSGL
YSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKICVEPKSSDKTHTCPPCPAPELLGGP
SVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNS
TYRVVSVSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKICVEPKSSDKTHTCPPCPAP
ELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPR
EEQYNSTYRVVSVPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKP
REEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTL
PPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTIPPVLDSDGSFFLYSKLT
VDKSRWQQGNVFSCSVMITEALIINHYTQKSLSLSPG
    Click to Show/Hide
Light Chain Sequence
EIVLTQSPATLSLSPGERATLSCRASQSVDYNGISYMHWYQQKPGQAPRLLIYAASNVQS
GIPARFSGSGSGTDFTLTISSLEPEDFAVYYCQQSIEDPPTFGGGTKVEIKRTVAAPSVF
IFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLS
STLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC
    Click to Show/Hide
Each Antibody-drug Conjugate Related to This Antibody
Full Information of The Activity Data of The ADC(s) Related to This Antibody
ABBV-011 [Phase 1 (discontinued)]
Identified from the Human Clinical Data
Click To Hide/Show 3 Activity Data Related to This Level
Experiment 1 Reporting the Activity Date of This ADC [1]
Efficacy Data Objective Response Rate (ORR)
25%
Patients Enrolled
Eligible participants have relapsed/refractory SCLC (1-3 prior lines), measurable disease (RECIST v1.1), ECOG 0-1, and adequate organ function. Key exclusions: cirrhosis, cardiac disease (>6 months prior), active infections, autoimmune/neurologic conditions, or hypersensitivity to study drugs. SEZ6+ tumor tissue is required for Parts B/C. Additional exclusions for Part C include neuropathy ≥G2, IBD, or prior anti-PD-1/PD-L1 with unresolved irAEs.

   Click to Show/Hide
Administration Dosage
ABBV-011 was administered intravenously at doses from 0.3 to 2.0 mg/kg once every 3 weeks. Dose expansion was conducted in SEZ6-selected patients.
Related Clinical Trial
NCT Number NCT03639194  Clinical Status PHASE1
Clinical Description
A Phase I Study of ABBV-011 as a Single-Agent and in Combination With Budigalimab (ABBV-181) in Subjects With Relapsed or Refractory Small Cell Lung Cancer
Primary Endpoint
The study evaluates AEs, SAEs, DLTs, and determines MTD/RP2D for ABBV-011 alone and in combination with budigalimab over ~5 years, alongside monitoring vital signs, lab abnormalities, and ECG changes.
Other Endpoint
PK parameters (Cmax, AUC, Tmax, T1/2, etc.) and immunogenicity (ADA) for ABBV-011 are assessed. Efficacy endpoints include ORR, CBR, DOR, DOCB, PFS, and OS per RECIST v1.1 over ~5 years.
Experiment 2 Reporting the Activity Date of This ADC [1]
Efficacy Data Clinical benefit rate (CBR)
64%
Patients Enrolled
Eligible participants have relapsed/refractory SCLC (1-3 prior lines), measurable disease (RECIST v1.1), ECOG 0-1, and adequate organ function. Key exclusions: cirrhosis, cardiac disease (>6 months prior), active infections, autoimmune/neurologic conditions, or hypersensitivity to study drugs. SEZ6+ tumor tissue is required for Parts B/C. Additional exclusions for Part C include neuropathy ≥G2, IBD, or prior anti-PD-1/PD-L1 with unresolved irAEs.

   Click to Show/Hide
Administration Dosage
ABBV-011 was administered intravenously at doses from 0.3 to 2.0 mg/kg once every 3 weeks. Dose expansion was conducted in SEZ6-selected patients.
Related Clinical Trial
NCT Number NCT03639194  Clinical Status PHASE1
Clinical Description
A Phase I Study of ABBV-011 as a Single-Agent and in Combination With Budigalimab (ABBV-181) in Subjects With Relapsed or Refractory Small Cell Lung Cancer
Primary Endpoint
The study evaluates AEs, SAEs, DLTs, and determines MTD/RP2D for ABBV-011 alone and in combination with budigalimab over ~5 years, alongside monitoring vital signs, lab abnormalities, and ECG changes.
Other Endpoint
PK parameters (Cmax, AUC, Tmax, T1/2, etc.) and immunogenicity (ADA) for ABBV-011 are assessed. Efficacy endpoints include ORR, CBR, DOR, DOCB, PFS, and OS per RECIST v1.1 over ~5 years.
Experiment 3 Reporting the Activity Date of This ADC [2]
Related Clinical Trial
NCT Number NCT03639194  Clinical Status Phase 1
Clinical Description
A phase 1 study of ABBV-011 as a single-agent and in combination with budigalimab (ABBV-181) in subjects with relapsed or refractory small cell lung cancer.
Discovered Using Patient-derived Xenograft Model
Click To Hide/Show 22 Activity Data Related to This Level
Experiment 1 Reporting the Activity Date of This ADC [3]
Efficacy Data Tumor Growth Inhibition value (TGI) ≈ 15.30% Positive SEZ6 expression (SEZ6+++/++)
Method Description
ABBV-011 LD(NAC-LD19.10)=0.24 mg/kg.
In Vivo Model SCLC PDX model (PDX: LU64)
Experiment 2 Reporting the Activity Date of This ADC [3]
Efficacy Data Tumor Growth Inhibition value (TGI) ≈ 35.60% Positive SEZ6 expression (SEZ6+++/++)
Method Description
ABBV-011 induces efficient tumor cell killing in cell line-derived models of LU64 and LU149 cells with SC17 expression with high expression.
In Vivo Model Small cell lung cancer PDX model (PDX: LU149)
Experiment 3 Reporting the Activity Date of This ADC [3]
Efficacy Data Tumor Growth Inhibition value (TGI) ≈ 42.85% Negative SEZ6 expression (SEZ6-)
Method Description
ABBV-011 induces efficient tumor cell killing in cell line-derived models of LU64 and LU149 cells with SC17 expression with high expression.
In Vivo Model Small cell lung cancer PDX model (PDX: LU505)
Experiment 4 Reporting the Activity Date of This ADC [3]
Efficacy Data Tumor Growth Inhibition value (TGI) ≈ 45.90% Positive SEZ6 expression (SEZ6+++/++)
Method Description
ABBV-011 ADC=8mg/kg.
In Vivo Model SCLC PDX model (PDX: LU505)
Experiment 5 Reporting the Activity Date of This ADC [3]
Efficacy Data Tumor Growth Inhibition value (TGI) ≈ 71.70% Positive SEZ6 expression (SEZ6+++/++)
Method Description
ABBV-011 ADC=1 mg/kg.
In Vivo Model SCLC PDX model (PDX: LU149)
Experiment 6 Reporting the Activity Date of This ADC [3]
Efficacy Data Tumor Growth Inhibition value (TGI) ≈ 87% Positive SEZ6 expression (SEZ6+++/++)
Method Description
NAC-LD19.10 ADC=8mg/kg.
In Vivo Model SCLC PDX model (PDX: LU505)
Experiment 7 Reporting the Activity Date of This ADC [3]
Efficacy Data Tumor Growth Inhibition value (TGI) ≈ 89.80% Positive SEZ6 expression (SEZ6+++/++)
Method Description
ABBV-011 ADC=1 mg/kg.
In Vivo Model SCLC PDX model (PDX: LU95)
Experiment 8 Reporting the Activity Date of This ADC [3]
Efficacy Data Tumor Growth Inhibition value (TGI) ≈ 89.80% Positive SEZ6 expression (SEZ6+++/++)
Method Description
ABBV-011 induces efficient tumor cell killing in cell line-derived models of LU64 and LU149 cells with SC17 expression with high expression.
In Vivo Model Small cell lung cancer PDX model (PDX: LU149)
Experiment 9 Reporting the Activity Date of This ADC [3]
Efficacy Data Tumor Growth Inhibition value (TGI) ≈ 92% Positive SEZ6 expression (SEZ6+++/++)
Method Description
ABBV-011 ADC=0.5 mg/kg.
In Vivo Model SCLC PDX model (PDX: LU64)
Experiment 10 Reporting the Activity Date of This ADC [3]
Efficacy Data Tumor Growth Inhibition value (TGI) ≈ 93.50% Positive SEZ6 expression (SEZ6+++/++)
Method Description
ABBV-011 ADC=2 mg/kg.
In Vivo Model SCLC PDX model (PDX: LU149)
Experiment 11 Reporting the Activity Date of This ADC [3]
Efficacy Data Tumor Growth Inhibition value (TGI) ≈ 94.78% Positive SEZ6 expression (SEZ6+++/++)
Method Description
ABBV-011 induces efficient tumor cell killing in cell line-derived models of LU64 and LU149 cells with SC17 expression with high expression.
In Vivo Model Small cell lung cancer PDX model (PDX: LU95)
Experiment 12 Reporting the Activity Date of This ADC [3]
Efficacy Data Tumor Growth Inhibition value (TGI) ≈ 96% Positive SEZ6 expression (SEZ6+++/++)
Method Description
ABBV-011 induces efficient tumor cell killing in cell line-derived models of LU64 and LU149 cells with SC17 expression with high expression.
In Vivo Model Small cell lung cancer PDX model (PDX: LU64)
Experiment 13 Reporting the Activity Date of This ADC [3]
Efficacy Data Tumor Growth Inhibition value (TGI) ≈ 96.80% Positive SEZ6 expression (SEZ6+++/++)
Method Description
ABBV-011 ADC=2 mg/kg.
In Vivo Model SCLC PDX model (PDX: LU95)
Experiment 14 Reporting the Activity Date of This ADC [3]
Efficacy Data Tumor Growth Inhibition value (TGI) ≈ 97% Positive SEZ6 expression (SEZ6+++/++)
Method Description
ABBV-011 ADC=4 mg/kg.
In Vivo Model SCLC PDX model (PDX: LU95)
Experiment 15 Reporting the Activity Date of This ADC [3]
Efficacy Data Tumor Growth Inhibition value (TGI) ≈ 98% Positive SEZ6 expression (SEZ6+++/++)
Method Description
ABBV-011 ADC=1 mg/kg.
In Vivo Model SCLC PDX model (PDX: LU64)
Experiment 16 Reporting the Activity Date of This ADC [3]
Efficacy Data Tumor Growth Inhibition value (TGI) ≈ 98.40% Positive SEZ6 expression (SEZ6+++/++)
Method Description
ABBV-011 ADC=2 mg/kg.
In Vivo Model SCLC PDX model (PDX: LU64)
Experiment 17 Reporting the Activity Date of This ADC [3]
Efficacy Data Tumor Growth Inhibition value (TGI) ≈ 98.70% Positive SEZ6 expression (SEZ6+++/++)
Method Description
ABBV-011 ADC=4 mg/kg.
In Vivo Model SCLC PDX model (PDX: LU149)
Experiment 18 Reporting the Activity Date of This ADC [3]
Efficacy Data Tumor Growth Inhibition value (TGI) ≈ 99.60% Positive SEZ6 expression (SEZ6+++/++)
Method Description
ABBV-011 induces efficient tumor cell killing in cell line-derived models of LU64 and LU149 cells with SC17 expression with high expression.
In Vivo Model Small cell lung cancer PDX model (PDX: LU95)
Experiment 19 Reporting the Activity Date of This ADC [3]
Efficacy Data Tumor Growth Inhibition value (TGI) ≈ 99.80% Positive SEZ6 expression (SEZ6+++/++)
Method Description
ABBV-011 induces efficient tumor cell killing in cell line-derived models of LU64 and LU149 cells with SC17 expression with high expression.
In Vivo Model Small cell lung cancer PDX model (PDX: LU95)
Experiment 20 Reporting the Activity Date of This ADC [3]
Efficacy Data Tumor Growth Inhibition value (TGI) ≈ 100% Positive SEZ6 expression (SEZ6+++/++)
Method Description
ABBV-011 induces efficient tumor cell killing in cell line-derived models of LU64 and LU149 cells with SC17 expression with high expression.
In Vivo Model Small cell lung cancer PDX model (PDX: LU149)
Experiment 21 Reporting the Activity Date of This ADC [3]
Efficacy Data Tumor Growth Inhibition value (TGI) ≈ 100% Positive SEZ6 expression (SEZ6+++/++)
Method Description
ABBV-011 induces efficient tumor cell killing in cell line-derived models of LU64 and LU149 cells with SC17 expression with high expression.
In Vivo Model Small cell lung cancer PDX model (PDX: LU64)
Experiment 22 Reporting the Activity Date of This ADC [3]
Efficacy Data Tumor Growth Inhibition value (TGI) ≈ 100% Positive SEZ6 expression (SEZ6+++/++)
Method Description
ABBV-011 induces efficient tumor cell killing in cell line-derived models of LU64 and LU149 cells with SC17 expression with high expression.
In Vivo Model Small cell lung cancer PDX model (PDX: LU64)
References
Ref 1 A Study of ABBV-011 Alone and in Combination With Budigalimab (ABBV-181) in Participants With Relapsed or Refractory Small Cell Lung Cancer
Ref 2 A Phase I Study of ABBV-011 as a Single-Agent and in Combination With Budigalimab (ABBV-181) in Subjects With Relapsed or Refractory Small Cell Lung Cancer, NCT03639194
Ref 3 ABBV-011, A Novel, Calicheamicin-Based Antibody-Drug Conjugate, Targets SEZ6 to Eradicate Small Cell Lung Cancer Tumors. Mol Cancer Ther. 2022 Jun 1;21(6):986-998.