Antibody Information
General Information of This Antibody
| Antibody ID | ANI0PWRSL |
|||||
|---|---|---|---|---|---|---|
| Antibody Name | SC17 |
|||||
| Antibody Type | Monoclonal antibody (mAb) |
|||||
| Antibody Subtype | Humanized IgG1-kappa |
|||||
| Antigen Name | Seizure protein 6 homolog (SEZ6) |
Antigen Info | ||||
| Click to Show/Hide the Sequence Information of This Antibody | ||||||
| Heavy Chain Sequence |
EVQLVQSGAEVKICPGESLKISCKGSGYSFTSSWINWVRQMPGKGLEWMGRIYPGEGDTN
YNGNFEGQVTISADKSISTAYLQWSSLKASDTAMYYCTRGLVMDYWGQGTLVTVSSASTK GPSVFPLAPSSKSTSGGTAALGCLVICDYFPEPVTVSWNSGALTSGVH1TFPAVLQSSGL YSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKICVEPKSSDKTHTCPPCPAPELLGGP SVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNS TYRVVSVSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKICVEPKSSDKTHTCPPCPAP ELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPR EEQYNSTYRVVSVPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKP REEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTL PPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTIPPVLDSDGSFFLYSKLT VDKSRWQQGNVFSCSVMITEALIINHYTQKSLSLSPG Click to Show/Hide
|
|||||
| Light Chain Sequence |
EIVLTQSPATLSLSPGERATLSCRASQSVDYNGISYMHWYQQKPGQAPRLLIYAASNVQS
GIPARFSGSGSGTDFTLTISSLEPEDFAVYYCQQSIEDPPTFGGGTKVEIKRTVAAPSVF IFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLS STLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC Click to Show/Hide
|
|||||
Each Antibody-drug Conjugate Related to This Antibody
Full Information of The Activity Data of The ADC(s) Related to This Antibody
ABBV-011 [Phase 1 (Terminated)]
Identified from the Human Clinical Data
| Experiment 1 Reporting the Activity Date of This ADC | [1] | ||||
| Related Clinical Trial | |||||
| NCT Number | NCT03639194 | Clinical Status | Phase 1 | ||
| Clinical Description |
A phase 1 study of ABBV-011 as a single-agent and in combination with budigalimab (ABBV-181) in subjects with relapsed or refractory small cell lung cancer.
|
||||
Discovered Using Patient-derived Xenograft Model
| Experiment 1 Reporting the Activity Date of This ADC | [2] | ||||
| Efficacy Data | Tumor Growth Inhibition value (TGI) | ≈ 15.30% (Day 28) | Positive SEZ6 expression (SEZ6+++/++) | ||
| Method Description |
ABBV-011 LD(NAC-LD19.10)=0.24 mg/kg.
|
||||
| In Vivo Model | SCLC PDX model (PDX: LU64) | ||||
| Experiment 2 Reporting the Activity Date of This ADC | [2] | ||||
| Efficacy Data | Tumor Growth Inhibition value (TGI) | ≈ 35.60% (Day 28) | Positive SEZ6 expression (SEZ6+++/++) | ||
| Method Description |
ABBV-011 induces efficient tumor cell killing in cell line-derived models of LU64 and LU149 cells with SC17 expression with high expression.
|
||||
| In Vivo Model | Small cell lung cancer PDX model (PDX: LU149) | ||||
| Experiment 3 Reporting the Activity Date of This ADC | [2] | ||||
| Efficacy Data | Tumor Growth Inhibition value (TGI) | ≈ 42.85% (Day 14) | Negative SEZ6 expression (SEZ6-) | ||
| Method Description |
ABBV-011 induces efficient tumor cell killing in cell line-derived models of LU64 and LU149 cells with SC17 expression with high expression.
|
||||
| In Vivo Model | Small cell lung cancer PDX model (PDX: LU505) | ||||
| Experiment 4 Reporting the Activity Date of This ADC | [2] | ||||
| Efficacy Data | Tumor Growth Inhibition value (TGI) | ≈ 45.90% (Day 21) | Positive SEZ6 expression (SEZ6+++/++) | ||
| Method Description |
ABBV-011 ADC=8mg/kg.
|
||||
| In Vivo Model | SCLC PDX model (PDX: LU505) | ||||
| Experiment 5 Reporting the Activity Date of This ADC | [2] | ||||
| Efficacy Data | Tumor Growth Inhibition value (TGI) | ≈ 71.70% (Day 21) | Positive SEZ6 expression (SEZ6+++/++) | ||
| Method Description |
ABBV-011 ADC=1 mg/kg.
|
||||
| In Vivo Model | SCLC PDX model (PDX: LU149) | ||||
| Experiment 6 Reporting the Activity Date of This ADC | [2] | ||||
| Efficacy Data | Tumor Growth Inhibition value (TGI) | ≈ 87.00% (Day 21) | Positive SEZ6 expression (SEZ6+++/++) | ||
| Method Description |
NAC-LD19.10 ADC=8mg/kg.
|
||||
| In Vivo Model | SCLC PDX model (PDX: LU505) | ||||
| Experiment 7 Reporting the Activity Date of This ADC | [2] | ||||
| Efficacy Data | Tumor Growth Inhibition value (TGI) | ≈ 89.80% (Day 29) | Positive SEZ6 expression (SEZ6+++/++) | ||
| Method Description |
ABBV-011 ADC=1 mg/kg.
|
||||
| In Vivo Model | SCLC PDX model (PDX: LU95) | ||||
| Experiment 8 Reporting the Activity Date of This ADC | [2] | ||||
| Efficacy Data | Tumor Growth Inhibition value (TGI) | ≈ 89.80% (Day 28) | Positive SEZ6 expression (SEZ6+++/++) | ||
| Method Description |
ABBV-011 induces efficient tumor cell killing in cell line-derived models of LU64 and LU149 cells with SC17 expression with high expression.
|
||||
| In Vivo Model | Small cell lung cancer PDX model (PDX: LU149) | ||||
| Experiment 9 Reporting the Activity Date of This ADC | [2] | ||||
| Efficacy Data | Tumor Growth Inhibition value (TGI) | ≈ 92.00% (Day 28) | Positive SEZ6 expression (SEZ6+++/++) | ||
| Method Description |
ABBV-011 ADC=0.5 mg/kg.
|
||||
| In Vivo Model | SCLC PDX model (PDX: LU64) | ||||
| Experiment 10 Reporting the Activity Date of This ADC | [2] | ||||
| Efficacy Data | Tumor Growth Inhibition value (TGI) | ≈ 93.50% (Day 21) | Positive SEZ6 expression (SEZ6+++/++) | ||
| Method Description |
ABBV-011 ADC=2 mg/kg.
|
||||
| In Vivo Model | SCLC PDX model (PDX: LU149) | ||||
| Experiment 11 Reporting the Activity Date of This ADC | [2] | ||||
| Efficacy Data | Tumor Growth Inhibition value (TGI) | ≈ 94.78% (Day 28) | Positive SEZ6 expression (SEZ6+++/++) | ||
| Method Description |
ABBV-011 induces efficient tumor cell killing in cell line-derived models of LU64 and LU149 cells with SC17 expression with high expression.
|
||||
| In Vivo Model | Small cell lung cancer PDX model (PDX: LU95) | ||||
| Experiment 12 Reporting the Activity Date of This ADC | [2] | ||||
| Efficacy Data | Tumor Growth Inhibition value (TGI) | ≈ 96.00% (Day 28) | Positive SEZ6 expression (SEZ6+++/++) | ||
| Method Description |
ABBV-011 induces efficient tumor cell killing in cell line-derived models of LU64 and LU149 cells with SC17 expression with high expression.
|
||||
| In Vivo Model | Small cell lung cancer PDX model (PDX: LU64) | ||||
| Experiment 13 Reporting the Activity Date of This ADC | [2] | ||||
| Efficacy Data | Tumor Growth Inhibition value (TGI) | ≈ 96.80% (Day 29) | Positive SEZ6 expression (SEZ6+++/++) | ||
| Method Description |
ABBV-011 ADC=2 mg/kg.
|
||||
| In Vivo Model | SCLC PDX model (PDX: LU95) | ||||
| Experiment 14 Reporting the Activity Date of This ADC | [2] | ||||
| Efficacy Data | Tumor Growth Inhibition value (TGI) | ≈ 97.00% (Day 29) | Positive SEZ6 expression (SEZ6+++/++) | ||
| Method Description |
ABBV-011 ADC=4 mg/kg.
|
||||
| In Vivo Model | SCLC PDX model (PDX: LU95) | ||||
| Experiment 15 Reporting the Activity Date of This ADC | [2] | ||||
| Efficacy Data | Tumor Growth Inhibition value (TGI) | ≈ 98.00% (Day 28) | Positive SEZ6 expression (SEZ6+++/++) | ||
| Method Description |
ABBV-011 ADC=1 mg/kg.
|
||||
| In Vivo Model | SCLC PDX model (PDX: LU64) | ||||
| Experiment 16 Reporting the Activity Date of This ADC | [2] | ||||
| Efficacy Data | Tumor Growth Inhibition value (TGI) | ≈ 98.40% (Day 28) | Positive SEZ6 expression (SEZ6+++/++) | ||
| Method Description |
ABBV-011 ADC=2 mg/kg.
|
||||
| In Vivo Model | SCLC PDX model (PDX: LU64) | ||||
| Experiment 17 Reporting the Activity Date of This ADC | [2] | ||||
| Efficacy Data | Tumor Growth Inhibition value (TGI) | ≈ 98.70% (Day 21) | Positive SEZ6 expression (SEZ6+++/++) | ||
| Method Description |
ABBV-011 ADC=4 mg/kg.
|
||||
| In Vivo Model | SCLC PDX model (PDX: LU149) | ||||
| Experiment 18 Reporting the Activity Date of This ADC | [2] | ||||
| Efficacy Data | Tumor Growth Inhibition value (TGI) | ≈ 99.60% (Day 28) | Positive SEZ6 expression (SEZ6+++/++) | ||
| Method Description |
ABBV-011 induces efficient tumor cell killing in cell line-derived models of LU64 and LU149 cells with SC17 expression with high expression.
|
||||
| In Vivo Model | Small cell lung cancer PDX model (PDX: LU95) | ||||
| Experiment 19 Reporting the Activity Date of This ADC | [2] | ||||
| Efficacy Data | Tumor Growth Inhibition value (TGI) | ≈ 99.80% (Day 28) | Positive SEZ6 expression (SEZ6+++/++) | ||
| Method Description |
ABBV-011 induces efficient tumor cell killing in cell line-derived models of LU64 and LU149 cells with SC17 expression with high expression.
|
||||
| In Vivo Model | Small cell lung cancer PDX model (PDX: LU95) | ||||
| Experiment 20 Reporting the Activity Date of This ADC | [2] | ||||
| Efficacy Data | Tumor Growth Inhibition value (TGI) | ≈ 100.00% (Day 28) | Positive SEZ6 expression (SEZ6+++/++) | ||
| Method Description |
ABBV-011 induces efficient tumor cell killing in cell line-derived models of LU64 and LU149 cells with SC17 expression with high expression.
|
||||
| In Vivo Model | Small cell lung cancer PDX model (PDX: LU64) | ||||
| Experiment 21 Reporting the Activity Date of This ADC | [2] | ||||
| Efficacy Data | Tumor Growth Inhibition value (TGI) | ≈ 100.00% (Day 28) | Positive SEZ6 expression (SEZ6+++/++) | ||
| Method Description |
ABBV-011 induces efficient tumor cell killing in cell line-derived models of LU64 and LU149 cells with SC17 expression with high expression.
|
||||
| In Vivo Model | Small cell lung cancer PDX model (PDX: LU64) | ||||
| Experiment 22 Reporting the Activity Date of This ADC | [2] | ||||
| Efficacy Data | Tumor Growth Inhibition value (TGI) | ≈ 100.00% (Day 28) | Positive SEZ6 expression (SEZ6+++/++) | ||
| Method Description |
ABBV-011 induces efficient tumor cell killing in cell line-derived models of LU64 and LU149 cells with SC17 expression with high expression.
|
||||
| In Vivo Model | Small cell lung cancer PDX model (PDX: LU149) | ||||
References
