Antibody Information

General Information of This Antibody

Antibody ID	ANI0PWRSL
Antibody Name	SC17
Antibody Type	Monoclonal antibody (mAb)
Antibody Subtype	Humanized IgG1-kappa
Antigen Name	Seizure protein 6 homolog (SEZ6)	Antigen Info
Click to Show/Hide the Sequence Information of This Antibody
Heavy Chain Sequence	EVQLVQSGAEVKICPGESLKISCKGSGYSFTSSWINWVRQMPGKGLEWMGRIYPGEGDTN YNGNFEGQVTISADKSISTAYLQWSSLKASDTAMYYCTRGLVMDYWGQGTLVTVSSASTK GPSVFPLAPSSKSTSGGTAALGCLVICDYFPEPVTVSWNSGALTSGVH1TFPAVLQSSGL YSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKICVEPKSSDKTHTCPPCPAPELLGGP SVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNS TYRVVSVSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKICVEPKSSDKTHTCPPCPAP ELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPR EEQYNSTYRVVSVPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKP REEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTL PPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTIPPVLDSDGSFFLYSKLT VDKSRWQQGNVFSCSVMITEALIINHYTQKSLSLSPG Click to Show/Hide
Light Chain Sequence	EIVLTQSPATLSLSPGERATLSCRASQSVDYNGISYMHWYQQKPGQAPRLLIYAASNVQS GIPARFSGSGSGTDFTLTISSLEPEDFAVYYCQQSIEDPPTFGGGTKVEIKRTVAAPSVF IFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLS STLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC Click to Show/Hide

Each Antibody-drug Conjugate Related to This Antibody

Full Information of The Activity Data of The ADC(s) Related to This Antibody

SC-011 [Phase 1]

ADC Info

Identified from the Human Clinical Data

Click To Hide/Show 1 Activity Data Related to This Level

Experiment 1 Reporting the Activity Date of This ADC				[1]
*Related Clinical Trial*
NCT Number	NCT03639194	Clinical Status	Phase 1
Clinical Description	A phase 1 study of ABBV-011 as a single-agent and in combination with budigalimab (ABBV-181) in subjects with relapsed or refractory small cell lung cancer.

Discovered Using Patient-derived Xenograft Model

Click To Hide/Show 22 Activity Data Related to This Level

Experiment 1 Reporting the Activity Date of This ADC				[2]
Efficacy Data	Tumor Growth Inhibition value (TGI)	≈ 15.30% (Day 28)	Positive SEZ6 expression (SEZ6+++/++)
Method Description	ABBV-011 LD(NAC-LD19.10)=0.24 mg/kg.
In Vivo Model	SCLC PDX model (PDX: LU64)
Experiment 2 Reporting the Activity Date of This ADC				[2]
Efficacy Data	Tumor Growth Inhibition value (TGI)	≈ 35.60% (Day 28)	Positive SEZ6 expression (SEZ6+++/++)
Method Description	ABBV-011 induces efficient tumor cell killing in cell line-derived models of LU64 and LU149 cells with SC17 expression with high expression.
In Vivo Model	Small cell lung cancer PDX model (PDX: LU149)
Experiment 3 Reporting the Activity Date of This ADC				[2]
Efficacy Data	Tumor Growth Inhibition value (TGI)	≈ 42.85% (Day 14)	Negative SEZ6 expression (SEZ6-)
Method Description	ABBV-011 induces efficient tumor cell killing in cell line-derived models of LU64 and LU149 cells with SC17 expression with high expression.
In Vivo Model	Small cell lung cancer PDX model (PDX: LU505)
Experiment 4 Reporting the Activity Date of This ADC				[2]
Efficacy Data	Tumor Growth Inhibition value (TGI)	≈ 45.90% (Day 21)	Positive SEZ6 expression (SEZ6+++/++)
Method Description	ABBV-011 ADC=8mg/kg.
In Vivo Model	SCLC PDX model (PDX: LU505)
Experiment 5 Reporting the Activity Date of This ADC				[2]
Efficacy Data	Tumor Growth Inhibition value (TGI)	≈ 71.70% (Day 21)	Positive SEZ6 expression (SEZ6+++/++)
Method Description	ABBV-011 ADC=1 mg/kg.
In Vivo Model	SCLC PDX model (PDX: LU149)
Experiment 6 Reporting the Activity Date of This ADC				[2]
Efficacy Data	Tumor Growth Inhibition value (TGI)	≈ 87.00% (Day 21)	Positive SEZ6 expression (SEZ6+++/++)
Method Description	NAC-LD19.10 ADC=8mg/kg.
In Vivo Model	SCLC PDX model (PDX: LU505)
Experiment 7 Reporting the Activity Date of This ADC				[2]
Efficacy Data	Tumor Growth Inhibition value (TGI)	≈ 89.80% (Day 29)	Positive SEZ6 expression (SEZ6+++/++)
Method Description	ABBV-011 ADC=1 mg/kg.
In Vivo Model	SCLC PDX model (PDX: LU95)
Experiment 8 Reporting the Activity Date of This ADC				[2]
Efficacy Data	Tumor Growth Inhibition value (TGI)	≈ 89.80% (Day 28)	Positive SEZ6 expression (SEZ6+++/++)
Method Description	ABBV-011 induces efficient tumor cell killing in cell line-derived models of LU64 and LU149 cells with SC17 expression with high expression.
In Vivo Model	Small cell lung cancer PDX model (PDX: LU149)
Experiment 9 Reporting the Activity Date of This ADC				[2]
Efficacy Data	Tumor Growth Inhibition value (TGI)	≈ 92.00% (Day 28)	Positive SEZ6 expression (SEZ6+++/++)
Method Description	ABBV-011 ADC=0.5 mg/kg.
In Vivo Model	SCLC PDX model (PDX: LU64)
Experiment 10 Reporting the Activity Date of This ADC				[2]
Efficacy Data	Tumor Growth Inhibition value (TGI)	≈ 93.50% (Day 21)	Positive SEZ6 expression (SEZ6+++/++)
Method Description	ABBV-011 ADC=2 mg/kg.
In Vivo Model	SCLC PDX model (PDX: LU149)
Experiment 11 Reporting the Activity Date of This ADC				[2]
Efficacy Data	Tumor Growth Inhibition value (TGI)	≈ 94.78% (Day 28)	Positive SEZ6 expression (SEZ6+++/++)
Method Description	ABBV-011 induces efficient tumor cell killing in cell line-derived models of LU64 and LU149 cells with SC17 expression with high expression.
In Vivo Model	Small cell lung cancer PDX model (PDX: LU95)
Experiment 12 Reporting the Activity Date of This ADC				[2]
Efficacy Data	Tumor Growth Inhibition value (TGI)	≈ 96.00% (Day 28)	Positive SEZ6 expression (SEZ6+++/++)
Method Description	ABBV-011 induces efficient tumor cell killing in cell line-derived models of LU64 and LU149 cells with SC17 expression with high expression.
In Vivo Model	Small cell lung cancer PDX model (PDX: LU64)
Experiment 13 Reporting the Activity Date of This ADC				[2]
Efficacy Data	Tumor Growth Inhibition value (TGI)	≈ 96.80% (Day 29)	Positive SEZ6 expression (SEZ6+++/++)
Method Description	ABBV-011 ADC=2 mg/kg.
In Vivo Model	SCLC PDX model (PDX: LU95)
Experiment 14 Reporting the Activity Date of This ADC				[2]
Efficacy Data	Tumor Growth Inhibition value (TGI)	≈ 97.00% (Day 29)	Positive SEZ6 expression (SEZ6+++/++)
Method Description	ABBV-011 ADC=4 mg/kg.
In Vivo Model	SCLC PDX model (PDX: LU95)
Experiment 15 Reporting the Activity Date of This ADC				[2]
Efficacy Data	Tumor Growth Inhibition value (TGI)	≈ 98.00% (Day 28)	Positive SEZ6 expression (SEZ6+++/++)
Method Description	ABBV-011 ADC=1 mg/kg.
In Vivo Model	SCLC PDX model (PDX: LU64)
Experiment 16 Reporting the Activity Date of This ADC				[2]
Efficacy Data	Tumor Growth Inhibition value (TGI)	≈ 98.40% (Day 28)	Positive SEZ6 expression (SEZ6+++/++)
Method Description	ABBV-011 ADC=2 mg/kg.
In Vivo Model	SCLC PDX model (PDX: LU64)
Experiment 17 Reporting the Activity Date of This ADC				[2]
Efficacy Data	Tumor Growth Inhibition value (TGI)	≈ 98.70% (Day 21)	Positive SEZ6 expression (SEZ6+++/++)
Method Description	ABBV-011 ADC=4 mg/kg.
In Vivo Model	SCLC PDX model (PDX: LU149)
Experiment 18 Reporting the Activity Date of This ADC				[2]
Efficacy Data	Tumor Growth Inhibition value (TGI)	≈ 99.60% (Day 28)	Positive SEZ6 expression (SEZ6+++/++)
Method Description	ABBV-011 induces efficient tumor cell killing in cell line-derived models of LU64 and LU149 cells with SC17 expression with high expression.
In Vivo Model	Small cell lung cancer PDX model (PDX: LU95)
Experiment 19 Reporting the Activity Date of This ADC				[2]
Efficacy Data	Tumor Growth Inhibition value (TGI)	≈ 99.80% (Day 28)	Positive SEZ6 expression (SEZ6+++/++)
Method Description	ABBV-011 induces efficient tumor cell killing in cell line-derived models of LU64 and LU149 cells with SC17 expression with high expression.
In Vivo Model	Small cell lung cancer PDX model (PDX: LU95)
Experiment 20 Reporting the Activity Date of This ADC				[2]
Efficacy Data	Tumor Growth Inhibition value (TGI)	≈ 100.00% (Day 28)	Positive SEZ6 expression (SEZ6+++/++)
Method Description	ABBV-011 induces efficient tumor cell killing in cell line-derived models of LU64 and LU149 cells with SC17 expression with high expression.
In Vivo Model	Small cell lung cancer PDX model (PDX: LU64)
Experiment 21 Reporting the Activity Date of This ADC				[2]
Efficacy Data	Tumor Growth Inhibition value (TGI)	≈ 100.00% (Day 28)	Positive SEZ6 expression (SEZ6+++/++)
Method Description	ABBV-011 induces efficient tumor cell killing in cell line-derived models of LU64 and LU149 cells with SC17 expression with high expression.
In Vivo Model	Small cell lung cancer PDX model (PDX: LU64)
Experiment 22 Reporting the Activity Date of This ADC				[2]
Efficacy Data	Tumor Growth Inhibition value (TGI)	≈ 100.00% (Day 28)	Positive SEZ6 expression (SEZ6+++/++)
Method Description	ABBV-011 induces efficient tumor cell killing in cell line-derived models of LU64 and LU149 cells with SC17 expression with high expression.
In Vivo Model	Small cell lung cancer PDX model (PDX: LU149)

References

Ref 1	A Phase I Study of ABBV-011 as a Single-Agent and in Combination With Budigalimab (ABBV-181) in Subjects With Relapsed or Refractory Small Cell Lung Cancer, NCT03639194
Ref 2	ABBV-011, A Novel, Calicheamicin-Based Antibody-Drug Conjugate, Targets SEZ6 to Eradicate Small Cell Lung Cancer Tumors. Mol Cancer Ther. 2022 Jun 1;21(6):986-998.

If you find any error in data or bug in web service, please kindly report it to Dr. Shen et al.

Antibody Information

Citation

Visitor Map

Correspondence

Prof. Feng ZHU (zhufeng@zju.edu.cn)

Prof. Xiaowu DONG (dongxw@zju.edu.cn)

Prof. Luo FANG (fangluo@zjcc.org.cn)