General Information of This Antibody (ID: ANI0OKRWC)
Antibody Name
IMC-D11
Antibody Type
Monoclonal antibody (mAb)
Antibody Subtype
Humanized IgG1-kappa
Antigen Name
Fibroblast growth factor receptor 3 (FGFR3)
 Antigen Info 
Click to Show/Hide the Sequence Information of This Antibody
Heavy Chain Sequence
EVQLVQSGAEVKKPGASVKVSCKASGYMFTSYGISWVRQAPGQGLEWMGWVSTYNGDTNY
AQKFQGRVTVTTDTSTSTAYMELRSLRSEDTAVYYCARVLGYYDSIDGYYYGMDVWGQGT
TVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFP
AVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPKSCDKTHTCPPCPA
PELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKP
REEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTL
PPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLT
VDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
    Click to Show/Hide
Light Chain Sequence
.QSVLTQPPSLSVAPGKTATFTCGGNNIGDKSVHWYRQKPGQAPVLVMYLDTERPSGIPE
RMSGSNFGNTATLTITRVEAEDEADYYCQVWDSGSDHVVFGGGTKLTVLGQPKAAPSVTL
FPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSY
LSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPAECS
    Click to Show/Hide
Each Antibody-drug Conjugate Related to This Antibody
Full Information of The Activity Data of The ADC(s) Related to This Antibody
LY3076226 [Phase 1 (discontinued)]
Identified from the Human Clinical Data
Click To Hide/Show 1 Activity Data Related to This Level
Experiment 1 Reporting the Activity Date of This ADC [1]
Patients Enrolled
Eligible participants had advanced/metastatic cancer (Part B: FGFR3-altered bladder cancer), adequate organ function, and resolved prior treatment toxicities (Grade ≤1). Exclusions included recent investigational therapy, corneal/skin disorders (Grade ≥2), active infections, significant cardiac conditions (QTcF >480ms, NYHA III/IV), CNS metastases requiring steroids, or secondary malignancies impacting study interpretation. Reproductive-age participants adhered to contraception protocols.

   Click to Show/Hide
Administration Dosage
Part A (dose escalation in advanced cancer): LY3076226 administered intravenously (IV) on day 1 of each 21 day cycle. Part B (dose expansion in advanced urothelial carcinoma): LY3076226 administered IV on day 1 of each 21 day cycle.
Related Clinical Trial
NCT Number NCT02529553  Clinical Status PHASE1
Clinical Description
A Phase 1 Study of LY3076226, a Fibroblast Growth Factor Receptor 3 (FGFR3) Antibody-Drug Conjugate, in Patients With Advanced or Metastatic Cancer
Primary Endpoint
The MTD of LY3076226 was determined as the highest dose with <33% probability of DLT during Cycle 1 (21 days), establishing a safe dosing threshold for subsequent phases.
Other Endpoint
PK analysis for Cmax and AUC was conducted pre- and postdose (0.05-72 hours) in Cycles 1 and 3. Tumor response (CR/PR per RECIST 1.1) was assessed through Cycle 3, day 21, with CR requiring complete lesion disappearance and PR a ≥30% target lesion reduction.
References
Ref 1 A Study of LY3076226 in Participants With Advanced or Metastatic Cancer