General Information of This Antibody (ID: ANI0HLSGA)
Antibody Name
Avelumab
Organization
Merck Serono SA; EMD Serono, Inc.; Pfizer Inc.
Indication
Renal cell carcinoma; Urothelial carcinoma; Intractable cytopenia
Approval Date
Mar. 2017
Synonyms
MSB0010682; MSB-0010682; MSB0010718C; MSB-0010718C
   Click to Show/Hide
Antibody Type
Monoclonal antibody (mAb)
Antibody Subtype
Humanized IgG1-kappa
Antigen Name
Programmed cell death 1 ligand 1 (CD274)
 Antigen Info 
ChEMBI ID
CHEMBL3833373
PDB ID
4nki
DrugBank ID
DB11945
Drug Central ID
5221
Click to Show/Hide the Sequence Information of This Antibody
Heavy Chain Sequence
EVQLLESGGGLVQPGGSLRLSCAASGFTFSSYIMMWVRQAPGKGLEWVSSIYPSGGITFY
ADTVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARIKLGTVTTVDYWGQGTLVTVSS
ASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSS
GLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGG
PSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYN
STYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDE
LTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRW
QQGNVFSCSVMHEALHNHYTQKSLSLSPGK
    Click to Show/Hide
Light Chain Sequence
QSALTQPASVSGSPGQSITISCTGTSSDVGGYNYVSWYQQHPGKAPKLMIYDVSNRPSGV
SNRFSGSKSGNTASLTISGLQAEDEADYYCSSYTSSSTRVFGTGTKVTVLGQPKANPTVT
LFPPSSEELQANKATLVCLISDFYPGAVTVAWKADGSPVKAGVETTKPSKQSNNKYAASS
YLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTECS
    Click to Show/Hide
Each Antibody-drug Conjugate Related to This Antibody
Full Information of The Activity Data of The ADC(s) Related to This Antibody
PD-L1 ADC 1 [Investigative]
Revealed Based on the Cell Line Data
Click To Hide/Show 4 Activity Data Related to This Level
Experiment 1 Reporting the Activity Date of This ADC [1]
Efficacy Data Half Maximal Inhibitory Concentration (IC50)
265.3 nM
High PD-L1 expression (PD-L1+++)
Method Description
The in vitro cytotoxicity of ADC 1 and ADC 2 was evaluated in three PD-L1-positive cell lines, i.e., Calu-1, MDA-MB-231, and SK-MES, and one PD-L1-negative cell line, i.e., AsPC-1.
In Vitro Model Lung squamous cell carcinoma SK-MES-1 cells CVCL_0630
Experiment 2 Reporting the Activity Date of This ADC [1]
Efficacy Data Half Maximal Inhibitory Concentration (IC50) > 663.08 nM Negative PD-L1 expression (PD-L1-)
Method Description
The in vitro cytotoxicity of ADC 1 and ADC 2 was evaluated in three PD-L1-positive cell lines, i.e., Calu-1, MDA-MB-231, and SK-MES, and one PD-L1-negative cell line, i.e., AsPC-1.
In Vitro Model Pancreatic ductal adenocarcinoma AsPC-1 cells CVCL_0152
Experiment 3 Reporting the Activity Date of This ADC [1]
Efficacy Data Half Maximal Inhibitory Concentration (IC50) > 663.08 nM High PD-L1 expression (PD-L1+++)
Method Description
The in vitro cytotoxicity of ADC 1 and ADC 2 was evaluated in three PD-L1-positive cell lines, i.e., Calu-1, MDA-MB-231, and SK-MES, and one PD-L1-negative cell line, i.e., AsPC-1.
In Vitro Model Breast adenocarcinoma MDA-MB-231 cells CVCL_0062
Experiment 4 Reporting the Activity Date of This ADC [1]
Efficacy Data Half Maximal Inhibitory Concentration (IC50) > 663.08 nM High PD-L1 expression (PD-L1+++)
Method Description
The in vitro cytotoxicity of ADC 1 and ADC 2 was evaluated in three PD-L1-positive cell lines, i.e., Calu-1, MDA-MB-231, and SK-MES, and one PD-L1-negative cell line, i.e., AsPC-1.
In Vitro Model Lung squamous cell carcinoma Calu-1 cells CVCL_0608
PD-L1 ADC 2 [Investigative]
Revealed Based on the Cell Line Data
Click To Hide/Show 4 Activity Data Related to This Level
Experiment 1 Reporting the Activity Date of This ADC [1]
Efficacy Data Half Maximal Inhibitory Concentration (IC50)
272.1 nM
High PD-L1 expression (PD-L1+++)
Method Description
The in vitro cytotoxicity of ADC 1 and ADC 2 was evaluated in three PD-L1-positive cell lines, i.e., Calu-1, MDA-MB-231, and SK-MES, and one PD-L1-negative cell line, i.e., AsPC-1.
In Vitro Model Lung squamous cell carcinoma SK-MES-1 cells CVCL_0630
Experiment 2 Reporting the Activity Date of This ADC [1]
Efficacy Data Half Maximal Inhibitory Concentration (IC50) > 653.93 nM Negative PD-L1 expression (PD-L1-)
Method Description
The in vitro cytotoxicity of ADC 1 and ADC 2 was evaluated in three PD-L1-positive cell lines, i.e., Calu-1, MDA-MB-231, and SK-MES, and one PD-L1-negative cell line, i.e., AsPC-1.
In Vitro Model Pancreatic ductal adenocarcinoma AsPC-1 cells CVCL_0152
Experiment 3 Reporting the Activity Date of This ADC [1]
Efficacy Data Half Maximal Inhibitory Concentration (IC50) > 653.93 nM High PD-L1 expression (PD-L1+++)
Method Description
The in vitro cytotoxicity of ADC 1 and ADC 2 was evaluated in three PD-L1-positive cell lines, i.e., Calu-1, MDA-MB-231, and SK-MES, and one PD-L1-negative cell line, i.e., AsPC-1.
In Vitro Model Breast adenocarcinoma MDA-MB-231 cells CVCL_0062
Experiment 4 Reporting the Activity Date of This ADC [1]
Efficacy Data Half Maximal Inhibitory Concentration (IC50) > 653.93 nM High PD-L1 expression (PD-L1+++)
Method Description
The in vitro cytotoxicity of ADC 1 and ADC 2 was evaluated in three PD-L1-positive cell lines, i.e., Calu-1, MDA-MB-231, and SK-MES, and one PD-L1-negative cell line, i.e., AsPC-1.
In Vitro Model Lung squamous cell carcinoma Calu-1 cells CVCL_0608
WO2023232144A1ADC27 [Investigative]
Discovered Using Cell Line-derived Xenograft Model
Click To Hide/Show 2 Activity Data Related to This Level
Experiment 1 Reporting the Activity Date of This ADC [2]
Efficacy Data Max Tumor Growth lnhibition value (TGl) (d)
20-50 %
Positive TLR expression (TLR+++/++)
Method Description
ADC27 was tested in mouse M38 CRC model in C57BL/6 mice, 3 mg/kg, QWx3, IV
In Vivo Model Mouse MC38 CRC Model in C57BL/6 Mice
Experiment 2 Reporting the Activity Date of This ADC [2]
Efficacy Data Max Tumor Growth lnhibition value (TGl) (d)
20-50 %
Positive TLR expression (TLR+++/++)
Method Description
ADC27 was tested in mouse M38 CRC model in C57BL/6 mice, 2.5 mg/kg, QWx2, IV
In Vivo Model Mouse MC38 CRC Model in C57BL/6 Mice
WO2023232144A1ADC29 [Investigative]
Discovered Using Cell Line-derived Xenograft Model
Click To Hide/Show 2 Activity Data Related to This Level
Experiment 1 Reporting the Activity Date of This ADC [2]
Efficacy Data Max Tumor Growth lnhibition value (TGl) (d) < 20% Positive TLR expression (TLR+++/++)
Method Description
ADC29 was tested in mouse M38 CRC model in C57BL/6 mice, 2.5 mg/kg, QWx2, IV
In Vivo Model Mouse MC38 CRC Model in C57BL/6 Mice
Experiment 2 Reporting the Activity Date of This ADC [2]
Efficacy Data Max Tumor Growth lnhibition value (TGl) (d) < 20% Positive TLR expression (TLR+++/++)
Method Description
ADC29 was tested in mouse M38 CRC model in C57BL/6 mice, 2.5 mg/kg, QWx2, IV
In Vivo Model Mouse MC38 CRC Model in C57BL/6 Mice
WO2023232144A1ADC26 [Investigative]
Discovered Using Cell Line-derived Xenograft Model
Click To Hide/Show 1 Activity Data Related to This Level
Experiment 1 Reporting the Activity Date of This ADC [2]
Efficacy Data Max Tumor Growth lnhibition value (TGl) (d) > 50% Positive TLR expression (TLR+++/++)
Method Description
ADC26 was tested in mouse M38 CRC model in C57BL/6 mice, 3 mg/kg, QWx3, IV
In Vivo Model Mouse MC38 CRC Model in C57BL/6 Mice
WO2023232144A1ADC28 [Investigative]
Discovered Using Cell Line-derived Xenograft Model
Click To Hide/Show 1 Activity Data Related to This Level
Experiment 1 Reporting the Activity Date of This ADC [2]
Efficacy Data Max Tumor Growth lnhibition value (TGl) (d) > 50% Positive TLR expression (TLR+++/++)
Method Description
ADC28 was tested in mouse M38 CRC model in C57BL/6 mice, 3 mg/kg, QWx3, IV
In Vivo Model Mouse MC38 CRC Model in C57BL/6 Mice
WO2023232144A1ADC42 [Investigative]
Discovered Using Cell Line-derived Xenograft Model
Click To Hide/Show 1 Activity Data Related to This Level
Experiment 1 Reporting the Activity Date of This ADC [2]
Efficacy Data Max Tumor Growth lnhibition value (TGl) (d) > 50% Positive TLR expression (TLR+++/++)
Method Description
ADC42 was tested in mouse M38 CRC model in C57BL/6 mice, 2.5 mg/kg, QWx2, IV
In Vivo Model Mouse MC38 CRC Model in C57BL/6 Mice
WO2023232144A1ADC43 [Investigative]
Discovered Using Cell Line-derived Xenograft Model
Click To Hide/Show 1 Activity Data Related to This Level
Experiment 1 Reporting the Activity Date of This ADC [2]
Efficacy Data Max Tumor Growth lnhibition value (TGl) (d) > 50% Positive TLR expression (TLR+++/++)
Method Description
ADC43 was tested in mouse M38 CRC model in C57BL/6 mice, 2.5 mg/kg, QWx2, IV
In Vivo Model Mouse MC38 CRC Model in C57BL/6 Mice
WO2024105206A1 1p-Avelu [Investigative]
Revealed Based on the Cell Line Data
Click To Hide/Show 6 Activity Data Related to This Level
Experiment 1 Reporting the Activity Date of This ADC [3]
Efficacy Data Half Maximal inhibitory Concentration (lC50)
10- 99 nM
Method Description
After cell counting a defined cell number was sowed into a 96-well culture plate with white bottom (from Costar #3610) (NCI H69: 2000 cells/well) in total volume 100 uL. The cells (except MOLM-13 cells, these cells were directly treated) were then incubated in an incubator at 37°C and 5 % carbon dioxide. After 48 h, the medium was replaced. The treatment started by adding the test compounds in 10 uL of culture medium to the cells in triplicates. Concentrations ranging from 10-5 M to 10-13 M were chosen. Two identical treated sets of samples were prepared. One set was treated with the test compound alone and was added followed by a 96 h incubation in an incubator at 37°C and 5 % carbon dioxide.

   Click to Show/Hide
In Vitro Model Lung small cell carcinoma, Small cell lung cancer NCI-H69 cells (-NE) CVCL_1579
Experiment 2 Reporting the Activity Date of This ADC [3]
Efficacy Data Half Maximal inhibitory Concentration (lC50)
10- 99 nM
Method Description
After cell counting a defined cell number was sowed into a 96-well culture plate with white bottom (from Costar #3610) (NCI H69: 2000 cells/well) in total volume 100 uL. The cells (except MOLM-13 cells, these cells were directly treated) were then incubated in an incubator at 37°C and 5 % carbon dioxide. After 48 h, the medium was replaced. The treatment started by adding the test compounds in 10 uL of culture medium to the cells in triplicates. Concentrations ranging from 10-5 M to 10-13 M were chosen. Two identical treated sets of samples were prepared. One set was treated with the test compound alone, whereas to the second set the test compound and 5nM hum.neutrophil elastase were added followed by a 96 h incubation in an incubator at 37°C and 5 % carbon dioxide.

   Click to Show/Hide
In Vitro Model Lung small cell carcinoma, Small cell lung cancer NCI-H69 cells (+NE) CVCL_1579
Experiment 3 Reporting the Activity Date of This ADC [3]
Efficacy Data Half Maximal inhibitory Concentration (lC50)
103&#4599 nM
Method Description
The cells were cultivated according to the standard method using the growth media suggest by provider The test was carried out by detaching the cells with a solution of Accutase in PBS buffer (fromBiochrom AG #L2143).
In Vitro Model Plasma cell myeloma, Multiple myeloma NCI H929 cells CVCL_1600
Experiment 4 Reporting the Activity Date of This ADC [3]
Efficacy Data Half Maximal inhibitory Concentration (lC50)
103&#4599 nM
Method Description
The cells were cultivated according to the standard method using the growth media suggest by provider The test was carried out by detaching the cells with a solution of Accutase in PBS buffer (fromBiochrom AG #L2143).
In Vitro Model Plasma cell myeloma, Multiple myeloma NCI H929 cells CVCL_1600
Experiment 5 Reporting the Activity Date of This ADC [3]
Efficacy Data Activity Concentration at -50% (AC50)
10- 99 nM
Method Description
After cell counting a defined cell number was sowed into a 96-well culture plate with white bottom (from Costar #3610) (NCI H292: 2500 cells/well) in total volume 100 uL. The cells (except MOLM-13 cells, these cells were directly treated) were then incubated in an incubator at 37°C and 5 % carbon dioxide. After 48 h, the medium was replaced. The treatment started by adding the test compounds in 10 uL of culture medium to the cells in triplicates. Concentrations ranging from 10-5 M to 10-13 M were chosen. Two identical treated sets of samples were prepared. One set was treated with the test compound alone, whereas to the second set the test compound and 5nM hum.neutrophil elastase were added followed by a 96 h incubation in an incubator at 37°C and 5 % carbon dioxide.

   Click to Show/Hide
In Vitro Model Plasma cell myeloma, Multiple myeloma NCI-H929 cells (+NE) CVCL_1600
Experiment 6 Reporting the Activity Date of This ADC [3]
Efficacy Data Activity Concentration at -50% (AC50)
100- 999 nM
Method Description
After cell counting a defined cell number was sowed into a 96-well culture plate with white bottom (from Costar #3610) (NCI H292: 2500 cells/well) in total volume 100 uL. The cells (except MOLM-13 cells, these cells were directly treated) were then incubated in an incubator at 37°C and 5 % carbon dioxide. After 48 h, the medium was replaced. The treatment started by adding the test compounds in 10 uL of culture medium to the cells in triplicates. Concentrations ranging from 10-5 M to 10-13 M were chosen. Two identical treated sets of samples were prepared. One set was treated with the test compound alone and was added followed by a 96 h incubation in an incubator at 37°C and 5 % carbon dioxide.

   Click to Show/Hide
In Vitro Model Plasma cell myeloma, Multiple myeloma NCI-H929 cells (-NE) CVCL_1600
WO2024105206A1 23p-Avelu 2 [Investigative]
Revealed Based on the Cell Line Data
Click To Hide/Show 8 Activity Data Related to This Level
Experiment 1 Reporting the Activity Date of This ADC [3]
Efficacy Data Half Maximal inhibitory Concentration (lC50)
10- 99 nM
Method Description
After cell counting a defined cell number was sowed into a 96-well culture plate with white bottom (from Costar #3610) (NCI H69: 2000 cells/well) in total volume 100 uL. The cells (except MOLM-13 cells, these cells were directly treated) were then incubated in an incubator at 37°C and 5 % carbon dioxide. After 48 h, the medium was replaced. The treatment started by adding the test compounds in 10 uL of culture medium to the cells in triplicates. Concentrations ranging from 10-5 M to 10-13 M were chosen. Two identical treated sets of samples were prepared. One set was treated with the test compound alone and was added followed by a 96 h incubation in an incubator at 37°C and 11 % carbon dioxide.

   Click to Show/Hide
In Vitro Model Lung small cell carcinoma, Small cell lung cancer NCI-H69 cells (-NE) CVCL_1579
Experiment 2 Reporting the Activity Date of This ADC [3]
Efficacy Data Half Maximal inhibitory Concentration (lC50)
10- 99 nM
Method Description
After cell counting a defined cell number was sowed into a 96-well culture plate with white bottom (from Costar #3610) (NCI H69: 2000 cells/well) in total volume 100 uL. The cells (except MOLM-13 cells, these cells were directly treated) were then incubated in an incubator at 37°C and 5 % carbon dioxide. After 48 h, the medium was replaced. The treatment started by adding the test compounds in 10 uL of culture medium to the cells in triplicates. Concentrations ranging from 10-5 M to 10-13 M were chosen. Two identical treated sets of samples were prepared. One set was treated with the test compound alone, whereas to the second set the test compound and 5nM hum.neutrophil elastase were added followed by a 96 h incubation in an incubator at 37°C and 11 % carbon dioxide.

   Click to Show/Hide
In Vitro Model Lung small cell carcinoma, Small cell lung cancer NCI-H69 cells (+NE) CVCL_1579
Experiment 3 Reporting the Activity Date of This ADC [3]
Efficacy Data Activity Concentration at -50% (AC50)
0.01- 1 nM
Method Description
After cell counting a defined cell number was sowed into a 96-well culture plate with white bottom (from Costar #3610) (786-0: 1500 cells/ well) in total volume 100 uL. The cells (except MOLM-13 cells, these cells were directly treated) were then incubated in an incubator at 37°C and 5 % carbon dioxide. After 48 h, the medium was replaced. The treatment started by adding the test compounds in 10 uL of culture medium to the cells in triplicates. Concentrations ranging from 10-5 M to 10-13 M were chosen. Two identical treated sets of samples were prepared. One set was treated with the test compound alone, whereas to the second set the test compound and 5nM hum.neutrophil elastase were added followed by a 96 h incubation in an incubator at 37°C and 29 % carbon dioxide.

   Click to Show/Hide
In Vitro Model Renal cell carcinoma 786-O cells (+NE) CVCL_1051
Experiment 4 Reporting the Activity Date of This ADC [3]
Efficacy Data Activity Concentration at -50% (AC50)
0.01- 1 nM
Method Description
After cell counting a defined cell number was sowed into a 96-well culture plate with white bottom (from Costar #3610) (NCI H292: 2500 cells/well) in total volume 100 uL. The cells (except MOLM-13 cells, these cells were directly treated) were then incubated in an incubator at 37°C and 5 % carbon dioxide. After 48 h, the medium was replaced. The treatment started by adding the test compounds in 10 uL of culture medium to the cells in triplicates. Concentrations ranging from 10-5 M to 10-13 M were chosen. Two identical treated sets of samples were prepared. One set was treated with the test compound alone, whereas to the second set the test compound and 5nM hum.neutrophil elastase were added followed by a 96 h incubation in an incubator at 37°C and 19 % carbon dioxide.

   Click to Show/Hide
In Vitro Model Plasma cell myeloma, Multiple myeloma NCI-H929 cells (+NE) CVCL_1600
Experiment 5 Reporting the Activity Date of This ADC [3]
Efficacy Data Activity Concentration at -50% (AC50)
1.0- 9.9 nM
Method Description
After cell counting a defined cell number was sowed into a 96-well culture plate with white bottom (from Costar #3610) (HT29: 1200 cells/well) in total volume 100 uL. The cells (except MOLM-13 cells, these cells were directly treated) were then incubated in an incubator at 37°C and 5 % carbon dioxide. After 48 h, the medium was replaced. The treatment started by adding the test compounds in 10 uL of culture medium to the cells in triplicates. Concentrations ranging from 10-5 M to 10-13 M were chosen. Two identical treated sets of samples were prepared. One set was treated with the test compound alone and was added followed by a 96 h incubation in an incubator at 37°C and 32 % carbon dioxide.

   Click to Show/Hide
In Vitro Model Colon adenocarcinoma HT29 cells (+NE) CVCL_0320
Experiment 6 Reporting the Activity Date of This ADC [3]
Efficacy Data Activity Concentration at -50% (AC50)
10- 99 nM
Method Description
After cell counting a defined cell number was sowed into a 96-well culture plate with white bottom (from Costar #3610) (786-0: 1500 cells/ well) in total volume 100 uL. The cells (except MOLM-13 cells, these cells were directly treated) were then incubated in an incubator at 37°C and 5 % carbon dioxide. After 48 h, the medium was replaced. The treatment started by adding the test compounds in 10 uL of culture medium to the cells in triplicates. Concentrations ranging from 10-5 M to 10-13 M were chosen. Two identical treated sets of samples were prepared. One set was treated with the test compound alone and was added followed by a 96 h incubation in an incubator at 37°C and 29 % carbon dioxide.

   Click to Show/Hide
In Vitro Model Renal cell carcinoma 786-O cells (-NE) CVCL_1051
Experiment 7 Reporting the Activity Date of This ADC [3]
Efficacy Data Activity Concentration at -50% (AC50)
10- 99 nM
Method Description
After cell counting a defined cell number was sowed into a 96-well culture plate with white bottom (from Costar #3610) (NCI H292: 2500 cells/well) in total volume 100 uL. The cells (except MOLM-13 cells, these cells were directly treated) were then incubated in an incubator at 37°C and 5 % carbon dioxide. After 48 h, the medium was replaced. The treatment started by adding the test compounds in 10 uL of culture medium to the cells in triplicates. Concentrations ranging from 10-5 M to 10-13 M were chosen. Two identical treated sets of samples were prepared. One set was treated with the test compound alone and was added followed by a 96 h incubation in an incubator at 37°C and 19 % carbon dioxide.

   Click to Show/Hide
In Vitro Model Plasma cell myeloma, Multiple myeloma NCI-H929 cells (-NE) CVCL_1600
Experiment 8 Reporting the Activity Date of This ADC [3]
Efficacy Data Activity Concentration at -50% (AC50)
100- 999 nM
Method Description
After cell counting a defined cell number was sowed into a 96-well culture plate with white bottom (from Costar #3610) (HT29: 1200 cells/well) in total volume 100 uL. The cells (except MOLM-13 cells, these cells were directly treated) were then incubated in an incubator at 37°C and 5 % carbon dioxide. After 48 h, the medium was replaced. The treatment started by adding the test compounds in 10 uL of culture medium to the cells in triplicates. Concentrations ranging from 10-5 M to 10-13 M were chosen. Two identical treated sets of samples were prepared. One set was treated with the test compound alone and was added followed by a 96 h incubation in an incubator at 37°C and 12 % carbon dioxide.

   Click to Show/Hide
In Vitro Model Colon adenocarcinoma HT29 cells (-NE) CVCL_0320
WO2024105206A1 29p-Avelu 1 [Investigative]
Revealed Based on the Cell Line Data
Click To Hide/Show 2 Activity Data Related to This Level
Experiment 1 Reporting the Activity Date of This ADC [3]
Efficacy Data Half Maximal inhibitory Concentration (lC50)
13&#459.9 nM
Method Description
The cells were cultivated according to the standard method using the growth media suggest by provider The test was carried out by detaching the cells with a solution of Accutase in PBS buffer (fromBiochrom AG #L2143).
In Vitro Model Plasma cell myeloma, Multiple myeloma NCI H929 cells CVCL_1600
Experiment 2 Reporting the Activity Date of This ADC [3]
Efficacy Data Half Maximal inhibitory Concentration (lC50)
103&#4599 nM
Method Description
The cells were cultivated according to the standard method using the growth media suggest by provider The test was carried out by detaching the cells with a solution of Accutase in PBS buffer (fromBiochrom AG #L2143).
In Vitro Model Plasma cell myeloma, Multiple myeloma NCI H929 cells CVCL_1600
WO2024105206A1 23p-Avelu 1 [Investigative]
Revealed Based on the Cell Line Data
Click To Hide/Show 2 Activity Data Related to This Level
Experiment 1 Reporting the Activity Date of This ADC [3]
Efficacy Data Half Maximal inhibitory Concentration (lC50)
103&#4599 nM
Method Description
The cells were cultivated according to the standard method using the growth media suggest by provider The test was carried out by detaching the cells with a solution of Accutase in PBS buffer (fromBiochrom AG #L2143).
In Vitro Model Plasma cell myeloma, Multiple myeloma NCI H929 cells CVCL_1600
Experiment 2 Reporting the Activity Date of This ADC [3]
Efficacy Data Half Maximal inhibitory Concentration (lC50)
103&#4599 nM
Method Description
The cells were cultivated according to the standard method using the growth media suggest by provider The test was carried out by detaching the cells with a solution of Accutase in PBS buffer (fromBiochrom AG #L2143).
In Vitro Model Plasma cell myeloma, Multiple myeloma NCI H929 cells CVCL_1600
WO2024105206A1 30p-Avelu 1 [Investigative]
Revealed Based on the Cell Line Data
Click To Hide/Show 2 Activity Data Related to This Level
Experiment 1 Reporting the Activity Date of This ADC [3]
Efficacy Data Half Maximal inhibitory Concentration (lC50)
103&#4599 nM
Method Description
The cells were cultivated according to the standard method using the growth media suggest by provider The test was carried out by detaching the cells with a solution of Accutase in PBS buffer (fromBiochrom AG #L2143).
In Vitro Model Plasma cell myeloma, Multiple myeloma NCI H929 cells CVCL_1600
Experiment 2 Reporting the Activity Date of This ADC [3]
Efficacy Data Half Maximal inhibitory Concentration (lC50)
103&#4599 nM
Method Description
The cells were cultivated according to the standard method using the growth media suggest by provider The test was carried out by detaching the cells with a solution of Accutase in PBS buffer (fromBiochrom AG #L2143).
In Vitro Model Plasma cell myeloma, Multiple myeloma NCI H929 cells CVCL_1600
WO2024105206A1 31p-Avelu 1 [Investigative]
Revealed Based on the Cell Line Data
Click To Hide/Show 2 Activity Data Related to This Level
Experiment 1 Reporting the Activity Date of This ADC [3]
Efficacy Data Half Maximal inhibitory Concentration (lC50)
103&#4599 nM
Method Description
The cells were cultivated according to the standard method using the growth media suggest by provider The test was carried out by detaching the cells with a solution of Accutase in PBS buffer (fromBiochrom AG #L2143).
In Vitro Model Plasma cell myeloma, Multiple myeloma NCI H929 cells CVCL_1600
Experiment 2 Reporting the Activity Date of This ADC [3]
Efficacy Data Half Maximal inhibitory Concentration (lC50)
103&#4599 nM
Method Description
The cells were cultivated according to the standard method using the growth media suggest by provider The test was carried out by detaching the cells with a solution of Accutase in PBS buffer (fromBiochrom AG #L2143).
In Vitro Model Plasma cell myeloma, Multiple myeloma NCI H929 cells CVCL_1600
WO2024105206A1 32p-Avelu 1 [Investigative]
Revealed Based on the Cell Line Data
Click To Hide/Show 2 Activity Data Related to This Level
Experiment 1 Reporting the Activity Date of This ADC [3]
Efficacy Data Half Maximal inhibitory Concentration (lC50)
103&#4599 nM
Method Description
The cells were cultivated according to the standard method using the growth media suggest by provider The test was carried out by detaching the cells with a solution of Accutase in PBS buffer (fromBiochrom AG #L2143).
In Vitro Model Plasma cell myeloma, Multiple myeloma NCI H929 cells CVCL_1600
Experiment 2 Reporting the Activity Date of This ADC [3]
Efficacy Data Half Maximal inhibitory Concentration (lC50)
103&#4599 nM
Method Description
The cells were cultivated according to the standard method using the growth media suggest by provider The test was carried out by detaching the cells with a solution of Accutase in PBS buffer (fromBiochrom AG #L2143).
In Vitro Model Plasma cell myeloma, Multiple myeloma NCI H929 cells CVCL_1600
WO2024105206A1 34p-Avelu 1 [Investigative]
Revealed Based on the Cell Line Data
Click To Hide/Show 2 Activity Data Related to This Level
Experiment 1 Reporting the Activity Date of This ADC [3]
Efficacy Data Half Maximal inhibitory Concentration (lC50)
103&#4599 nM
Method Description
The cells were cultivated according to the standard method using the growth media suggest by provider The test was carried out by detaching the cells with a solution of Accutase in PBS buffer (fromBiochrom AG #L2143).
In Vitro Model Plasma cell myeloma, Multiple myeloma NCI H929 cells CVCL_1600
Experiment 2 Reporting the Activity Date of This ADC [3]
Efficacy Data Half Maximal inhibitory Concentration (lC50)
103&#4599 nM
Method Description
The cells were cultivated according to the standard method using the growth media suggest by provider The test was carried out by detaching the cells with a solution of Accutase in PBS buffer (fromBiochrom AG #L2143).
In Vitro Model Plasma cell myeloma, Multiple myeloma NCI H929 cells CVCL_1600
AU2020291014A1 IC-9 [Investigative]
Revealed Based on the Cell Line Data
Click To Hide/Show 1 Activity Data Related to This Level
Experiment 1 Reporting the Activity Date of This ADC [4]
Efficacy Data Half Maximal Effective Concentration (EC50)
161.03 nM
Method Description
Mycloid TNFa Secretion
In Vitro Model Mycloid Mycloid cells Homo sapiens
AU2020291014A1 IC-15 [Investigative]
Revealed Based on the Cell Line Data
Click To Hide/Show 1 Activity Data Related to This Level
Experiment 1 Reporting the Activity Date of This ADC [4]
Efficacy Data Half Maximal Effective Concentration (EC50)
199.5 nM
Method Description
Mycloid TNFa Secretion
In Vitro Model Mycloid Mycloid cells Homo sapiens
References
Ref 1 Development of bifunctional anti-PD-L1 antibody MMAE conjugate with cytotoxicity and immunostimulation. Bioorg Chem. 2021 Nov;116:105366.
Ref 2 Drug conjugates of imidazoquinoline amine derivatives, compositions and methods thereof
Ref 3 Antibody-drug conjugates cleavable in a tumor microenvironment
Ref 4 Aminobenzazepine compounds, immunoconjugates, and uses thereof