Antibody ID	ANI0HLSGA
Antibody Name	Avelumab
Organization	Merck Serono SA; EMD Serono, Inc.; Pfizer Inc.
Indication	Renal cell carcinoma; Urothelial carcinoma; Intractable cytopenia
Approval Date	Mar. 2017
Synonyms	MSB0010682; MSB-0010682; MSB0010718C; MSB-0010718C    Click to Show/Hide
Antibody Type	Monoclonal antibody (mAb)
Antibody Subtype	Humanized IgG1-kappa
Antigen Name	Programmed cell death 1 ligand 1 (CD274)					Antigen Info
ChEMBI ID	CHEMBL3833373
PDB ID	4nki
DrugBank ID	DB11945
Drug Central ID	5221
Click to Show/Hide the Sequence Information of This Antibody
Heavy Chain Sequence	EVQLLESGGGLVQPGGSLRLSCAASGFTFSSYIMMWVRQAPGKGLEWVSSIYPSGGITFY ADTVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARIKLGTVTTVDYWGQGTLVTVSS ASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSS GLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGG PSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYN STYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDE LTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRW QQGNVFSCSVMHEALHNHYTQKSLSLSPGK     Click to Show/Hide
Light Chain Sequence	QSALTQPASVSGSPGQSITISCTGTSSDVGGYNYVSWYQQHPGKAPKLMIYDVSNRPSGV SNRFSGSKSGNTASLTISGLQAEDEADYYCSSYTSSSTRVFGTGTKVTVLGQPKANPTVT LFPPSSEELQANKATLVCLISDFYPGAVTVAWKADGSPVKAGVETTKPSKQSNNKYAASS YLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTECS     Click to Show/Hide

Experiment 1 Reporting the Activity Date of This ADC					[1]
Efficacy Data	Half Maximal Inhibitory Concentration (IC50)	265.3 nM	High PD-L1 expression (PD-L1+++)
Method Description	The in vitro cytotoxicity of ADC 1 and ADC 2 was evaluated in three PD-L1-positive cell lines, i.e., Calu-1, MDA-MB-231, and SK-MES, and one PD-L1-negative cell line, i.e., AsPC-1.
In Vitro Model	Lung squamous cell carcinoma	SK-MES-1 cells		CVCL_0630
Experiment 2 Reporting the Activity Date of This ADC					[1]
Efficacy Data	Half Maximal Inhibitory Concentration (IC50)	> 663.08 nM	Negative PD-L1 expression (PD-L1-)
Method Description	The in vitro cytotoxicity of ADC 1 and ADC 2 was evaluated in three PD-L1-positive cell lines, i.e., Calu-1, MDA-MB-231, and SK-MES, and one PD-L1-negative cell line, i.e., AsPC-1.
In Vitro Model	Pancreatic ductal adenocarcinoma	AsPC-1 cells		CVCL_0152
Experiment 3 Reporting the Activity Date of This ADC					[1]
Efficacy Data	Half Maximal Inhibitory Concentration (IC50)	> 663.08 nM	High PD-L1 expression (PD-L1+++)
Method Description	The in vitro cytotoxicity of ADC 1 and ADC 2 was evaluated in three PD-L1-positive cell lines, i.e., Calu-1, MDA-MB-231, and SK-MES, and one PD-L1-negative cell line, i.e., AsPC-1.
In Vitro Model	Breast adenocarcinoma	MDA-MB-231 cells		CVCL_0062
Experiment 4 Reporting the Activity Date of This ADC					[1]
Efficacy Data	Half Maximal Inhibitory Concentration (IC50)	> 663.08 nM	High PD-L1 expression (PD-L1+++)
Method Description	The in vitro cytotoxicity of ADC 1 and ADC 2 was evaluated in three PD-L1-positive cell lines, i.e., Calu-1, MDA-MB-231, and SK-MES, and one PD-L1-negative cell line, i.e., AsPC-1.
In Vitro Model	Lung squamous cell carcinoma	Calu-1 cells		CVCL_0608

Experiment 1 Reporting the Activity Date of This ADC					[1]
Efficacy Data	Half Maximal Inhibitory Concentration (IC50)	272.1 nM	High PD-L1 expression (PD-L1+++)
Method Description	The in vitro cytotoxicity of ADC 1 and ADC 2 was evaluated in three PD-L1-positive cell lines, i.e., Calu-1, MDA-MB-231, and SK-MES, and one PD-L1-negative cell line, i.e., AsPC-1.
In Vitro Model	Lung squamous cell carcinoma	SK-MES-1 cells		CVCL_0630
Experiment 2 Reporting the Activity Date of This ADC					[1]
Efficacy Data	Half Maximal Inhibitory Concentration (IC50)	> 653.93 nM	Negative PD-L1 expression (PD-L1-)
Method Description	The in vitro cytotoxicity of ADC 1 and ADC 2 was evaluated in three PD-L1-positive cell lines, i.e., Calu-1, MDA-MB-231, and SK-MES, and one PD-L1-negative cell line, i.e., AsPC-1.
In Vitro Model	Pancreatic ductal adenocarcinoma	AsPC-1 cells		CVCL_0152
Experiment 3 Reporting the Activity Date of This ADC					[1]
Efficacy Data	Half Maximal Inhibitory Concentration (IC50)	> 653.93 nM	High PD-L1 expression (PD-L1+++)
Method Description	The in vitro cytotoxicity of ADC 1 and ADC 2 was evaluated in three PD-L1-positive cell lines, i.e., Calu-1, MDA-MB-231, and SK-MES, and one PD-L1-negative cell line, i.e., AsPC-1.
In Vitro Model	Breast adenocarcinoma	MDA-MB-231 cells		CVCL_0062
Experiment 4 Reporting the Activity Date of This ADC					[1]
Efficacy Data	Half Maximal Inhibitory Concentration (IC50)	> 653.93 nM	High PD-L1 expression (PD-L1+++)
Method Description	The in vitro cytotoxicity of ADC 1 and ADC 2 was evaluated in three PD-L1-positive cell lines, i.e., Calu-1, MDA-MB-231, and SK-MES, and one PD-L1-negative cell line, i.e., AsPC-1.
In Vitro Model	Lung squamous cell carcinoma	Calu-1 cells		CVCL_0608

Experiment 1 Reporting the Activity Date of This ADC					[2]
Efficacy Data	Max Tumor Growth lnhibition value (TGl) (d)	20-50 %	Positive TLR expression (TLR+++/++)
Method Description	ADC27 was tested in mouse M38 CRC model in C57BL/6 mice, 3 mg/kg, QWx3, IV
In Vivo Model	Mouse MC38 CRC Model in C57BL/6 Mice
Experiment 2 Reporting the Activity Date of This ADC					[2]
Efficacy Data	Max Tumor Growth lnhibition value (TGl) (d)	20-50 %	Positive TLR expression (TLR+++/++)
Method Description	ADC27 was tested in mouse M38 CRC model in C57BL/6 mice, 2.5 mg/kg, QWx2, IV
In Vivo Model	Mouse MC38 CRC Model in C57BL/6 Mice

Experiment 1 Reporting the Activity Date of This ADC					[2]
Efficacy Data	Max Tumor Growth lnhibition value (TGl) (d)	< 20%	Positive TLR expression (TLR+++/++)
Method Description	ADC29 was tested in mouse M38 CRC model in C57BL/6 mice, 2.5 mg/kg, QWx2, IV
In Vivo Model	Mouse MC38 CRC Model in C57BL/6 Mice
Experiment 2 Reporting the Activity Date of This ADC					[2]
Efficacy Data	Max Tumor Growth lnhibition value (TGl) (d)	< 20%	Positive TLR expression (TLR+++/++)
Method Description	ADC29 was tested in mouse M38 CRC model in C57BL/6 mice, 2.5 mg/kg, QWx2, IV
In Vivo Model	Mouse MC38 CRC Model in C57BL/6 Mice

Experiment 1 Reporting the Activity Date of This ADC					[2]
Efficacy Data	Max Tumor Growth lnhibition value (TGl) (d)	> 50%	Positive TLR expression (TLR+++/++)
Method Description	ADC26 was tested in mouse M38 CRC model in C57BL/6 mice, 3 mg/kg, QWx3, IV
In Vivo Model	Mouse MC38 CRC Model in C57BL/6 Mice

Experiment 1 Reporting the Activity Date of This ADC					[2]
Efficacy Data	Max Tumor Growth lnhibition value (TGl) (d)	> 50%	Positive TLR expression (TLR+++/++)
Method Description	ADC28 was tested in mouse M38 CRC model in C57BL/6 mice, 3 mg/kg, QWx3, IV
In Vivo Model	Mouse MC38 CRC Model in C57BL/6 Mice

Experiment 1 Reporting the Activity Date of This ADC					[2]
Efficacy Data	Max Tumor Growth lnhibition value (TGl) (d)	> 50%	Positive TLR expression (TLR+++/++)
Method Description	ADC42 was tested in mouse M38 CRC model in C57BL/6 mice, 2.5 mg/kg, QWx2, IV
In Vivo Model	Mouse MC38 CRC Model in C57BL/6 Mice

Experiment 1 Reporting the Activity Date of This ADC					[2]
Efficacy Data	Max Tumor Growth lnhibition value (TGl) (d)	> 50%	Positive TLR expression (TLR+++/++)
Method Description	ADC43 was tested in mouse M38 CRC model in C57BL/6 mice, 2.5 mg/kg, QWx2, IV
In Vivo Model	Mouse MC38 CRC Model in C57BL/6 Mice

Experiment 1 Reporting the Activity Date of This ADC					[3]
Efficacy Data	Half Maximal inhibitory Concentration (lC50)	10- 99 nM
Method Description	After cell counting a defined cell number was sowed into a 96-well culture plate with white bottom (from Costar #3610) (NCI H69: 2000 cells/well) in total volume 100 uL. The cells (except MOLM-13 cells, these cells were directly treated) were then incubated in an incubator at 37°C and 5 % carbon dioxide. After 48 h, the medium was replaced. The treatment started by adding the test compounds in 10 uL of culture medium to the cells in triplicates. Concentrations ranging from 10-5 M to 10-13 M were chosen. Two identical treated sets of samples were prepared. One set was treated with the test compound alone and was added followed by a 96 h incubation in an incubator at 37°C and 5 % carbon dioxide.    Click to Show/Hide
In Vitro Model	Lung small cell carcinoma, Small cell lung cancer	NCI-H69 cells (-NE)		CVCL_1579
Experiment 2 Reporting the Activity Date of This ADC					[3]
Efficacy Data	Half Maximal inhibitory Concentration (lC50)	10- 99 nM
Method Description	After cell counting a defined cell number was sowed into a 96-well culture plate with white bottom (from Costar #3610) (NCI H69: 2000 cells/well) in total volume 100 uL. The cells (except MOLM-13 cells, these cells were directly treated) were then incubated in an incubator at 37°C and 5 % carbon dioxide. After 48 h, the medium was replaced. The treatment started by adding the test compounds in 10 uL of culture medium to the cells in triplicates. Concentrations ranging from 10-5 M to 10-13 M were chosen. Two identical treated sets of samples were prepared. One set was treated with the test compound alone, whereas to the second set the test compound and 5nM hum.neutrophil elastase were added followed by a 96 h incubation in an incubator at 37°C and 5 % carbon dioxide.    Click to Show/Hide
In Vitro Model	Lung small cell carcinoma, Small cell lung cancer	NCI-H69 cells (+NE)		CVCL_1579
Experiment 3 Reporting the Activity Date of This ADC					[3]
Efficacy Data	Half Maximal inhibitory Concentration (lC50)	103&#4599 nM
Method Description	The cells were cultivated according to the standard method using the growth media suggest by provider The test was carried out by detaching the cells with a solution of Accutase in PBS buffer (fromBiochrom AG #L2143).
In Vitro Model	Plasma cell myeloma, Multiple myeloma	NCI H929 cells		CVCL_1600
Experiment 4 Reporting the Activity Date of This ADC					[3]
Efficacy Data	Half Maximal inhibitory Concentration (lC50)	103&#4599 nM
Method Description	The cells were cultivated according to the standard method using the growth media suggest by provider The test was carried out by detaching the cells with a solution of Accutase in PBS buffer (fromBiochrom AG #L2143).
In Vitro Model	Plasma cell myeloma, Multiple myeloma	NCI H929 cells		CVCL_1600
Experiment 5 Reporting the Activity Date of This ADC					[3]
Efficacy Data	Activity Concentration at -50% (AC50)	10- 99 nM
Method Description	After cell counting a defined cell number was sowed into a 96-well culture plate with white bottom (from Costar #3610) (NCI H292: 2500 cells/well) in total volume 100 uL. The cells (except MOLM-13 cells, these cells were directly treated) were then incubated in an incubator at 37°C and 5 % carbon dioxide. After 48 h, the medium was replaced. The treatment started by adding the test compounds in 10 uL of culture medium to the cells in triplicates. Concentrations ranging from 10-5 M to 10-13 M were chosen. Two identical treated sets of samples were prepared. One set was treated with the test compound alone, whereas to the second set the test compound and 5nM hum.neutrophil elastase were added followed by a 96 h incubation in an incubator at 37°C and 5 % carbon dioxide.    Click to Show/Hide
In Vitro Model	Plasma cell myeloma, Multiple myeloma	NCI-H929 cells (+NE)		CVCL_1600
Experiment 6 Reporting the Activity Date of This ADC					[3]
Efficacy Data	Activity Concentration at -50% (AC50)	100- 999 nM
Method Description	After cell counting a defined cell number was sowed into a 96-well culture plate with white bottom (from Costar #3610) (NCI H292: 2500 cells/well) in total volume 100 uL. The cells (except MOLM-13 cells, these cells were directly treated) were then incubated in an incubator at 37°C and 5 % carbon dioxide. After 48 h, the medium was replaced. The treatment started by adding the test compounds in 10 uL of culture medium to the cells in triplicates. Concentrations ranging from 10-5 M to 10-13 M were chosen. Two identical treated sets of samples were prepared. One set was treated with the test compound alone and was added followed by a 96 h incubation in an incubator at 37°C and 5 % carbon dioxide.    Click to Show/Hide
In Vitro Model	Plasma cell myeloma, Multiple myeloma	NCI-H929 cells (-NE)		CVCL_1600

Experiment 1 Reporting the Activity Date of This ADC					[3]
Efficacy Data	Half Maximal inhibitory Concentration (lC50)	10- 99 nM
Method Description	After cell counting a defined cell number was sowed into a 96-well culture plate with white bottom (from Costar #3610) (NCI H69: 2000 cells/well) in total volume 100 uL. The cells (except MOLM-13 cells, these cells were directly treated) were then incubated in an incubator at 37°C and 5 % carbon dioxide. After 48 h, the medium was replaced. The treatment started by adding the test compounds in 10 uL of culture medium to the cells in triplicates. Concentrations ranging from 10-5 M to 10-13 M were chosen. Two identical treated sets of samples were prepared. One set was treated with the test compound alone and was added followed by a 96 h incubation in an incubator at 37°C and 11 % carbon dioxide.    Click to Show/Hide
In Vitro Model	Lung small cell carcinoma, Small cell lung cancer	NCI-H69 cells (-NE)		CVCL_1579
Experiment 2 Reporting the Activity Date of This ADC					[3]
Efficacy Data	Half Maximal inhibitory Concentration (lC50)	10- 99 nM
Method Description	After cell counting a defined cell number was sowed into a 96-well culture plate with white bottom (from Costar #3610) (NCI H69: 2000 cells/well) in total volume 100 uL. The cells (except MOLM-13 cells, these cells were directly treated) were then incubated in an incubator at 37°C and 5 % carbon dioxide. After 48 h, the medium was replaced. The treatment started by adding the test compounds in 10 uL of culture medium to the cells in triplicates. Concentrations ranging from 10-5 M to 10-13 M were chosen. Two identical treated sets of samples were prepared. One set was treated with the test compound alone, whereas to the second set the test compound and 5nM hum.neutrophil elastase were added followed by a 96 h incubation in an incubator at 37°C and 11 % carbon dioxide.    Click to Show/Hide
In Vitro Model	Lung small cell carcinoma, Small cell lung cancer	NCI-H69 cells (+NE)		CVCL_1579
Experiment 3 Reporting the Activity Date of This ADC					[3]
Efficacy Data	Activity Concentration at -50% (AC50)	0.01- 1 nM
Method Description	After cell counting a defined cell number was sowed into a 96-well culture plate with white bottom (from Costar #3610) (786-0: 1500 cells/ well) in total volume 100 uL. The cells (except MOLM-13 cells, these cells were directly treated) were then incubated in an incubator at 37°C and 5 % carbon dioxide. After 48 h, the medium was replaced. The treatment started by adding the test compounds in 10 uL of culture medium to the cells in triplicates. Concentrations ranging from 10-5 M to 10-13 M were chosen. Two identical treated sets of samples were prepared. One set was treated with the test compound alone, whereas to the second set the test compound and 5nM hum.neutrophil elastase were added followed by a 96 h incubation in an incubator at 37°C and 29 % carbon dioxide.    Click to Show/Hide
In Vitro Model	Renal cell carcinoma	786-O cells (+NE)		CVCL_1051
Experiment 4 Reporting the Activity Date of This ADC					[3]
Efficacy Data	Activity Concentration at -50% (AC50)	0.01- 1 nM
Method Description	After cell counting a defined cell number was sowed into a 96-well culture plate with white bottom (from Costar #3610) (NCI H292: 2500 cells/well) in total volume 100 uL. The cells (except MOLM-13 cells, these cells were directly treated) were then incubated in an incubator at 37°C and 5 % carbon dioxide. After 48 h, the medium was replaced. The treatment started by adding the test compounds in 10 uL of culture medium to the cells in triplicates. Concentrations ranging from 10-5 M to 10-13 M were chosen. Two identical treated sets of samples were prepared. One set was treated with the test compound alone, whereas to the second set the test compound and 5nM hum.neutrophil elastase were added followed by a 96 h incubation in an incubator at 37°C and 19 % carbon dioxide.    Click to Show/Hide
In Vitro Model	Plasma cell myeloma, Multiple myeloma	NCI-H929 cells (+NE)		CVCL_1600
Experiment 5 Reporting the Activity Date of This ADC					[3]
Efficacy Data	Activity Concentration at -50% (AC50)	1.0- 9.9 nM
Method Description	After cell counting a defined cell number was sowed into a 96-well culture plate with white bottom (from Costar #3610) (HT29: 1200 cells/well) in total volume 100 uL. The cells (except MOLM-13 cells, these cells were directly treated) were then incubated in an incubator at 37°C and 5 % carbon dioxide. After 48 h, the medium was replaced. The treatment started by adding the test compounds in 10 uL of culture medium to the cells in triplicates. Concentrations ranging from 10-5 M to 10-13 M were chosen. Two identical treated sets of samples were prepared. One set was treated with the test compound alone and was added followed by a 96 h incubation in an incubator at 37°C and 32 % carbon dioxide.    Click to Show/Hide
In Vitro Model	Colon adenocarcinoma	HT29 cells (+NE)		CVCL_0320
Experiment 6 Reporting the Activity Date of This ADC					[3]
Efficacy Data	Activity Concentration at -50% (AC50)	10- 99 nM
Method Description	After cell counting a defined cell number was sowed into a 96-well culture plate with white bottom (from Costar #3610) (786-0: 1500 cells/ well) in total volume 100 uL. The cells (except MOLM-13 cells, these cells were directly treated) were then incubated in an incubator at 37°C and 5 % carbon dioxide. After 48 h, the medium was replaced. The treatment started by adding the test compounds in 10 uL of culture medium to the cells in triplicates. Concentrations ranging from 10-5 M to 10-13 M were chosen. Two identical treated sets of samples were prepared. One set was treated with the test compound alone and was added followed by a 96 h incubation in an incubator at 37°C and 29 % carbon dioxide.    Click to Show/Hide
In Vitro Model	Renal cell carcinoma	786-O cells (-NE)		CVCL_1051
Experiment 7 Reporting the Activity Date of This ADC					[3]
Efficacy Data	Activity Concentration at -50% (AC50)	10- 99 nM
Method Description	After cell counting a defined cell number was sowed into a 96-well culture plate with white bottom (from Costar #3610) (NCI H292: 2500 cells/well) in total volume 100 uL. The cells (except MOLM-13 cells, these cells were directly treated) were then incubated in an incubator at 37°C and 5 % carbon dioxide. After 48 h, the medium was replaced. The treatment started by adding the test compounds in 10 uL of culture medium to the cells in triplicates. Concentrations ranging from 10-5 M to 10-13 M were chosen. Two identical treated sets of samples were prepared. One set was treated with the test compound alone and was added followed by a 96 h incubation in an incubator at 37°C and 19 % carbon dioxide.    Click to Show/Hide
In Vitro Model	Plasma cell myeloma, Multiple myeloma	NCI-H929 cells (-NE)		CVCL_1600
Experiment 8 Reporting the Activity Date of This ADC					[3]
Efficacy Data	Activity Concentration at -50% (AC50)	100- 999 nM
Method Description	After cell counting a defined cell number was sowed into a 96-well culture plate with white bottom (from Costar #3610) (HT29: 1200 cells/well) in total volume 100 uL. The cells (except MOLM-13 cells, these cells were directly treated) were then incubated in an incubator at 37°C and 5 % carbon dioxide. After 48 h, the medium was replaced. The treatment started by adding the test compounds in 10 uL of culture medium to the cells in triplicates. Concentrations ranging from 10-5 M to 10-13 M were chosen. Two identical treated sets of samples were prepared. One set was treated with the test compound alone and was added followed by a 96 h incubation in an incubator at 37°C and 12 % carbon dioxide.    Click to Show/Hide
In Vitro Model	Colon adenocarcinoma	HT29 cells (-NE)		CVCL_0320

Experiment 1 Reporting the Activity Date of This ADC					[3]
Efficacy Data	Half Maximal inhibitory Concentration (lC50)	13&#459.9 nM
Method Description	The cells were cultivated according to the standard method using the growth media suggest by provider The test was carried out by detaching the cells with a solution of Accutase in PBS buffer (fromBiochrom AG #L2143).
In Vitro Model	Plasma cell myeloma, Multiple myeloma	NCI H929 cells		CVCL_1600
Experiment 2 Reporting the Activity Date of This ADC					[3]
Efficacy Data	Half Maximal inhibitory Concentration (lC50)	103&#4599 nM
Method Description	The cells were cultivated according to the standard method using the growth media suggest by provider The test was carried out by detaching the cells with a solution of Accutase in PBS buffer (fromBiochrom AG #L2143).
In Vitro Model	Plasma cell myeloma, Multiple myeloma	NCI H929 cells		CVCL_1600

Experiment 1 Reporting the Activity Date of This ADC					[3]
Efficacy Data	Half Maximal inhibitory Concentration (lC50)	103&#4599 nM
Method Description	The cells were cultivated according to the standard method using the growth media suggest by provider The test was carried out by detaching the cells with a solution of Accutase in PBS buffer (fromBiochrom AG #L2143).
In Vitro Model	Plasma cell myeloma, Multiple myeloma	NCI H929 cells		CVCL_1600
Experiment 2 Reporting the Activity Date of This ADC					[3]
Efficacy Data	Half Maximal inhibitory Concentration (lC50)	103&#4599 nM
Method Description	The cells were cultivated according to the standard method using the growth media suggest by provider The test was carried out by detaching the cells with a solution of Accutase in PBS buffer (fromBiochrom AG #L2143).
In Vitro Model	Plasma cell myeloma, Multiple myeloma	NCI H929 cells		CVCL_1600

Experiment 1 Reporting the Activity Date of This ADC					[3]
Efficacy Data	Half Maximal inhibitory Concentration (lC50)	103&#4599 nM
Method Description	The cells were cultivated according to the standard method using the growth media suggest by provider The test was carried out by detaching the cells with a solution of Accutase in PBS buffer (fromBiochrom AG #L2143).
In Vitro Model	Plasma cell myeloma, Multiple myeloma	NCI H929 cells		CVCL_1600
Experiment 2 Reporting the Activity Date of This ADC					[3]
Efficacy Data	Half Maximal inhibitory Concentration (lC50)	103&#4599 nM
Method Description	The cells were cultivated according to the standard method using the growth media suggest by provider The test was carried out by detaching the cells with a solution of Accutase in PBS buffer (fromBiochrom AG #L2143).
In Vitro Model	Plasma cell myeloma, Multiple myeloma	NCI H929 cells		CVCL_1600

Experiment 1 Reporting the Activity Date of This ADC					[3]
Efficacy Data	Half Maximal inhibitory Concentration (lC50)	103&#4599 nM
Method Description	The cells were cultivated according to the standard method using the growth media suggest by provider The test was carried out by detaching the cells with a solution of Accutase in PBS buffer (fromBiochrom AG #L2143).
In Vitro Model	Plasma cell myeloma, Multiple myeloma	NCI H929 cells		CVCL_1600
Experiment 2 Reporting the Activity Date of This ADC					[3]
Efficacy Data	Half Maximal inhibitory Concentration (lC50)	103&#4599 nM
Method Description	The cells were cultivated according to the standard method using the growth media suggest by provider The test was carried out by detaching the cells with a solution of Accutase in PBS buffer (fromBiochrom AG #L2143).
In Vitro Model	Plasma cell myeloma, Multiple myeloma	NCI H929 cells		CVCL_1600

Experiment 1 Reporting the Activity Date of This ADC					[3]
Efficacy Data	Half Maximal inhibitory Concentration (lC50)	103&#4599 nM
Method Description	The cells were cultivated according to the standard method using the growth media suggest by provider The test was carried out by detaching the cells with a solution of Accutase in PBS buffer (fromBiochrom AG #L2143).
In Vitro Model	Plasma cell myeloma, Multiple myeloma	NCI H929 cells		CVCL_1600
Experiment 2 Reporting the Activity Date of This ADC					[3]
Efficacy Data	Half Maximal inhibitory Concentration (lC50)	103&#4599 nM
Method Description	The cells were cultivated according to the standard method using the growth media suggest by provider The test was carried out by detaching the cells with a solution of Accutase in PBS buffer (fromBiochrom AG #L2143).
In Vitro Model	Plasma cell myeloma, Multiple myeloma	NCI H929 cells		CVCL_1600

Experiment 1 Reporting the Activity Date of This ADC					[3]
Efficacy Data	Half Maximal inhibitory Concentration (lC50)	103&#4599 nM
Method Description	The cells were cultivated according to the standard method using the growth media suggest by provider The test was carried out by detaching the cells with a solution of Accutase in PBS buffer (fromBiochrom AG #L2143).
In Vitro Model	Plasma cell myeloma, Multiple myeloma	NCI H929 cells		CVCL_1600
Experiment 2 Reporting the Activity Date of This ADC					[3]
Efficacy Data	Half Maximal inhibitory Concentration (lC50)	103&#4599 nM
Method Description	The cells were cultivated according to the standard method using the growth media suggest by provider The test was carried out by detaching the cells with a solution of Accutase in PBS buffer (fromBiochrom AG #L2143).
In Vitro Model	Plasma cell myeloma, Multiple myeloma	NCI H929 cells		CVCL_1600

Experiment 1 Reporting the Activity Date of This ADC					[4]
Efficacy Data	Half Maximal Effective Concentration (EC50)	161.03 nM
Method Description	Mycloid TNFa Secretion
In Vitro Model	Mycloid	Mycloid cells		Homo sapiens

Experiment 1 Reporting the Activity Date of This ADC					[4]
Efficacy Data	Half Maximal Effective Concentration (EC50)	199.5 nM
Method Description	Mycloid TNFa Secretion
In Vitro Model	Mycloid	Mycloid cells		Homo sapiens

Ref 1	Development of bifunctional anti-PD-L1 antibody MMAE conjugate with cytotoxicity and immunostimulation. Bioorg Chem. 2021 Nov;116:105366.
Ref 2	Drug conjugates of imidazoquinoline amine derivatives, compositions and methods thereof
Ref 3	Antibody-drug conjugates cleavable in a tumor microenvironment
Ref 4	Aminobenzazepine compounds, immunoconjugates, and uses thereof