Antibody Information

General Information of This Antibody
Antibody ID
ANI0GXLLM
Antibody Name
Anti-AXL mAb AXL02
Antibody Type
Monoclonal antibody (mAb)
Antibody Subtype
Humanized IgG1-kappa
Antigen Name
Tyrosine-protein kinase receptor UFO (AXL)
  Antigen Info 
Click to Show/Hide the Sequence Information of This Antibody
Heavy Chain Sequence
QVQLVQSGAEVKKPGASVKVSCKASGYPFTDFYINWVRQAPGQGLEWMGWIYPGSGNTKY
NEKFKGRVTLTVDTSISTAYMELSRLRSDDTAVYYCARSTGFFDYWGQGTLVTVSS
    Click to Show/Hide
Light Chain Sequence
EIVLTQSPATLSLSPGERATLSCSASSSIGYMYWYQQKPGQAPRLLIYLTSNLASGIPAR
FSGSGSGTDFTLTISSLEPEDFAVYYCQQWSSNPPTFGQGTKLEIK
    Click to Show/Hide
Each Antibody-drug Conjugate Related to This Antibody
Full Information of The Activity Data of The ADC(s) Related to This Antibody
AXL02-MMAE [Investigative]
 ADC Info 
Revealed Based on the Cell Line Data
Click To Hide/Show 7 Activity Data Related to This Level
Experiment 1 Reporting the Activity Date of This ADC [1]
Efficacy Data Half Maximal Inhibitory Concentration (IC50)
0.01 nM
High AXL expression (AXL+++)
Method Description
Tumor cells were plated in 96-well plates at predetermined density, treated with AXL02-MMAE or hIgG1-MMAE for 5-8 days to ensure that the doubling of the cells is sufficient. Then MTS reagent solution was added with replacing fresh medium, and cells were incubated for an appropriate time.
In Vitro Model Lung squamous cell carcinoma Calu-1 cells CVCL_0608
Experiment 2 Reporting the Activity Date of This ADC [1]
Efficacy Data Half Maximal Inhibitory Concentration (IC50)
0.03 nM
High AXL expression (AXL+++)
Method Description
Tumor cells were plated in 96-well plates at predetermined density, treated with AXL02-MMAE or hIgG1-MMAE for 5-8 days to ensure that the doubling of the cells is sufficient. Then MTS reagent solution was added with replacing fresh medium, and cells were incubated for an appropriate time.
In Vitro Model Lung large cell carcinoma LCLC-103H cells CVCL_1375
Experiment 3 Reporting the Activity Date of This ADC [1]
Efficacy Data Half Maximal Inhibitory Concentration (IC50)
0.04 nM
High AXL expression (AXL+++)
Method Description
Tumor cells were plated in 96-well plates at predetermined density, treated with AXL02-MMAE or hIgG1-MMAE for 5-8 days to ensure that the doubling of the cells is sufficient. Then MTS reagent solution was added with replacing fresh medium, and cells were incubated for an appropriate time.
In Vitro Model Breast adenocarcinoma MDA-MB-231 cells CVCL_0062
Experiment 4 Reporting the Activity Date of This ADC [1]
Efficacy Data Half Maximal Inhibitory Concentration (IC50)
0.04 nM
Moderate AXL expression (AXL++)
Method Description
Tumor cells were plated in 96-well plates at predetermined density, treated with AXL02-MMAE or hIgG1-MMAE for 5-8 days to ensure that the doubling of the cells is sufficient. Then MTS reagent solution was added with replacing fresh medium, and cells were incubated for an appropriate time.
In Vitro Model Glioblastoma U-87MG cells CVCL_0022
Experiment 5 Reporting the Activity Date of This ADC [1]
Efficacy Data Half Maximal Inhibitory Concentration (IC50)
0.05 nM±0.001 nM
Moderate AXL expression (AXL++)
Method Description
Tumor cells were plated in 96-well plates at predetermined density, treated with AXL02-MMAE or hIgG1-MMAE for 5-8 days to ensure that the doubling of the cells is sufficient. Then MTS reagent solution was added with replacing fresh medium, and cells were incubated for an appropriate time.
In Vitro Model Lung adenocarcinoma PC-9 cells CVCL_B260
Experiment 6 Reporting the Activity Date of This ADC [1]
Efficacy Data Half Maximal Inhibitory Concentration (IC50) > 100 nM Low AXL expression (AXL+)
Method Description
Tumor cells were plated in 96-well plates at predetermined density, treated with AXL02-MMAE or hIgG1-MMAE for 5-8 days to ensure that the doubling of the cells is sufficient. Then MTS reagent solution was added with replacing fresh medium, and cells were incubated for an appropriate time.
In Vitro Model Lung large cell carcinoma NCI-H460 cells CVCL_0459
Experiment 7 Reporting the Activity Date of This ADC [1]
Efficacy Data Half Maximal Inhibitory Concentration (IC50) > 100 nM Low AXL expression (AXL+)
Method Description
Tumor cells were plated in 96-well plates at predetermined density, treated with AXL02-MMAE or hIgG1-MMAE for 5-8 days to ensure that the doubling of the cells is sufficient. Then MTS reagent solution was added with replacing fresh medium, and cells were incubated for an appropriate time.
In Vitro Model Breast adenocarcinoma MDA-MB-453 cells CVCL_0418
References
Ref 1 AXL antibody and AXL-ADC mediate antitumor efficacy via targeting AXL in tumor-intrinsic epithelial-mesenchymal transition and tumor-associated M2-like macrophage. Acta Pharmacol Sin. 2023 Jun;44(6):1290-1303. doi: 10.1038/s41401-022-01047-6. Epub 2023 Jan 17.

If you find any error in data or bug in web service, please kindly report it to Dr. Shen et al.