Antibody Information
General Information of This Antibody
| Antibody ID | ANI0GXLLM |
|||||
|---|---|---|---|---|---|---|
| Antibody Name | Anti-AXL mAb AXL02 |
|||||
| Antibody Type | Monoclonal antibody (mAb) |
|||||
| Antibody Subtype | Humanized IgG1-kappa |
|||||
| Antigen Name | Tyrosine-protein kinase receptor UFO (AXL) |
Antigen Info | ||||
| Click to Show/Hide the Sequence Information of This Antibody | ||||||
| Heavy Chain Sequence |
QVQLVQSGAEVKKPGASVKVSCKASGYPFTDFYINWVRQAPGQGLEWMGWIYPGSGNTKY
NEKFKGRVTLTVDTSISTAYMELSRLRSDDTAVYYCARSTGFFDYWGQGTLVTVSS Click to Show/Hide
|
|||||
| Light Chain Sequence |
EIVLTQSPATLSLSPGERATLSCSASSSIGYMYWYQQKPGQAPRLLIYLTSNLASGIPAR
FSGSGSGTDFTLTISSLEPEDFAVYYCQQWSSNPPTFGQGTKLEIK Click to Show/Hide
|
|||||
Each Antibody-drug Conjugate Related to This Antibody
Full Information of The Activity Data of The ADC(s) Related to This Antibody
AXL02-MMAE [Investigative]
Revealed Based on the Cell Line Data
| Experiment 1 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Half Maximal Inhibitory Concentration (IC50) |
0.01 nM
|
High AXL expression (AXL+++) | ||
| Method Description |
Tumor cells were plated in 96-well plates at predetermined density, treated with AXL02-MMAE or hIgG1-MMAE for 5-8 days to ensure that the doubling of the cells is sufficient. Then MTS reagent solution was added with replacing fresh medium, and cells were incubated for an appropriate time.
|
||||
| In Vitro Model | Lung squamous cell carcinoma | Calu-1 cells | CVCL_0608 | ||
| Experiment 2 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Half Maximal Inhibitory Concentration (IC50) |
0.03 nM
|
High AXL expression (AXL+++) | ||
| Method Description |
Tumor cells were plated in 96-well plates at predetermined density, treated with AXL02-MMAE or hIgG1-MMAE for 5-8 days to ensure that the doubling of the cells is sufficient. Then MTS reagent solution was added with replacing fresh medium, and cells were incubated for an appropriate time.
|
||||
| In Vitro Model | Lung large cell carcinoma | LCLC-103H cells | CVCL_1375 | ||
| Experiment 3 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Half Maximal Inhibitory Concentration (IC50) |
0.04 nM
|
High AXL expression (AXL+++) | ||
| Method Description |
Tumor cells were plated in 96-well plates at predetermined density, treated with AXL02-MMAE or hIgG1-MMAE for 5-8 days to ensure that the doubling of the cells is sufficient. Then MTS reagent solution was added with replacing fresh medium, and cells were incubated for an appropriate time.
|
||||
| In Vitro Model | Breast adenocarcinoma | MDA-MB-231 cells | CVCL_0062 | ||
| Experiment 4 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Half Maximal Inhibitory Concentration (IC50) |
0.04 nM
|
Moderate AXL expression (AXL++) | ||
| Method Description |
Tumor cells were plated in 96-well plates at predetermined density, treated with AXL02-MMAE or hIgG1-MMAE for 5-8 days to ensure that the doubling of the cells is sufficient. Then MTS reagent solution was added with replacing fresh medium, and cells were incubated for an appropriate time.
|
||||
| In Vitro Model | Glioblastoma | U-87MG cells | CVCL_0022 | ||
| Experiment 5 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Half Maximal Inhibitory Concentration (IC50) |
0.05 nM±0.001 nM
|
Moderate AXL expression (AXL++) | ||
| Method Description |
Tumor cells were plated in 96-well plates at predetermined density, treated with AXL02-MMAE or hIgG1-MMAE for 5-8 days to ensure that the doubling of the cells is sufficient. Then MTS reagent solution was added with replacing fresh medium, and cells were incubated for an appropriate time.
|
||||
| In Vitro Model | Lung adenocarcinoma | PC-9 cells | CVCL_B260 | ||
| Experiment 6 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Half Maximal Inhibitory Concentration (IC50) | > 100 nM | Low AXL expression (AXL+) | ||
| Method Description |
Tumor cells were plated in 96-well plates at predetermined density, treated with AXL02-MMAE or hIgG1-MMAE for 5-8 days to ensure that the doubling of the cells is sufficient. Then MTS reagent solution was added with replacing fresh medium, and cells were incubated for an appropriate time.
|
||||
| In Vitro Model | Lung large cell carcinoma | NCI-H460 cells | CVCL_0459 | ||
| Experiment 7 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Half Maximal Inhibitory Concentration (IC50) | > 100 nM | Low AXL expression (AXL+) | ||
| Method Description |
Tumor cells were plated in 96-well plates at predetermined density, treated with AXL02-MMAE or hIgG1-MMAE for 5-8 days to ensure that the doubling of the cells is sufficient. Then MTS reagent solution was added with replacing fresh medium, and cells were incubated for an appropriate time.
|
||||
| In Vitro Model | Breast adenocarcinoma | MDA-MB-453 cells | CVCL_0418 | ||
References
If you find any error in data or bug in web service, please kindly report it to Dr. Shen et al.
