Antigen Information
General Information of This Antigen
| Antigen ID | TAR0XTVJE |
|||||
|---|---|---|---|---|---|---|
| Antigen Name | Tax1-binding protein 3 (TAX1BP3) |
|||||
| Gene Name | TAX1BP3 |
|||||
| Gene ID | ||||||
| Synonym | Glutaminase-interacting protein 3;Tax interaction protein 1;Tax-interacting protein 1 |
|||||
| Sequence |
MSYIPGQPVTAVVQRVEIHKLRQGENLILGFSIGGGIDQDPSQNPFSEDKTDKGIYVTRV
SEGGPAEIAGLQIGDKIMQVNGWDMTMVTHDQARKRLTKRSEEVVRLLVTRQSLQKAVQQ SMLS Click to Show/Hide
|
|||||
| Function |
May regulate a number of protein-protein interactions by competing for PDZ domain binding sites. Binds CTNNB1 and may thereby act as an inhibitor of the Wnt signaling pathway. Competes with LIN7A for KCNJ4 binding, and thereby promotes KCNJ4 internalization. May play a role in the Rho signaling pathway. May play a role in activation of CDC42 by the viral protein HPV16 E6.
Click to Show/Hide
|
|||||
| Uniprot Entry | ||||||
| HGNC ID | ||||||
| KEGG ID | ||||||
Each Antibody-drug Conjuate AND It's Component Related to This Antigen
Full List of The ADC Related to This Antigen
Anti-TIP1 mAb 7H5
| ADC Info | ADC Name | Payload | Target | Linker | Ref |
|---|---|---|---|---|---|
7H5-Val-Cit-MMAE |
Monomethyl auristatin E |
Microtubule (MT) |
Mc-Val-Cit-PABC |
[1] |
References
If you find any error in data or bug in web service, please kindly report it to Dr. Shen et al.
