Antigen Information
General Information of This Antigen
| Antigen ID | TAR0VTXKI |
|||||
|---|---|---|---|---|---|---|
| Antigen Name | Teratocarcinoma-derived growth factor 1 (TDGF1) |
|||||
| Gene Name | TDGF1 |
|||||
| Gene ID | ||||||
| Synonym | CRIPTO; Cripto-1 growth factor;Epidermal growth factor-like cripto protein CR1 |
|||||
| Sequence |
MDCRKMARFSYSVIWIMAISKVFELGLVAGLGHQEFARPSRGYLAFRDDSIWPQEEPAIR
PRSSQRVPPMGIQHSKELNRTCCLNGGTCMLGSFCACPPSFYGRNCEHDVRKENCGSVPH DTWLPKKCSLCKCWHGQLRCFPQAFLPGCDGLVMDEHLVASRTPELPPSARTTTFMLVGI CLSIQSYY Click to Show/Hide
|
|||||
| Family | COLEC10/COLEC11 family |
|||||
| Function |
GPI-anchored cell membrane protein involved in Nodal signaling. Cell-associated TDGF1 acts as a Nodal coreceptor in cis. Shedding of TDGF1 by TMEM8A modulates Nodal signaling by allowing soluble TDGF1 to act as a Nodal coreceptor on other cells. Could play a role in the determination of the epiblastic cells that subsequently give rise to the mesoderm.
Click to Show/Hide
|
|||||
| Uniprot Entry | ||||||
| HGNC ID | ||||||
| KEGG ID | ||||||
Each Antibody-drug Conjuate AND It's Component Related to This Antigen
Full List of The ADC Related to This Antigen
Anti-TDGF1 mAb huB3F6
| ADC Info | ADC Name | Payload | Target | Linker | Ref |
|---|---|---|---|---|---|
BIIB-015 |
Mertansine DM4 |
Microtubule (MT) |
N-succinimidyl 4-(2-pyridyldithio) butanoate (SPDB) |
[1] |
References
If you find any error in data or bug in web service, please kindly report it to Dr. Shen et al.
