Antigen Information
General Information of This Antigen
| Antigen ID | TAR0VKDND |
|||||
|---|---|---|---|---|---|---|
| Antigen Name | Vascular endothelial growth factor A (VEGFA) |
|||||
| Gene Name | VEGFA |
|||||
| Gene ID | ||||||
| Synonym | VEGF; Vascular permeability factor |
|||||
| Sequence |
MNFLLSWVHWSLALLLYLHHAKWSQAAPMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVD
IFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEM SFLQHNKCECRPKKDRARQEKKSVRGKGKGQKRKRKKSRYKSWSVYVGARCCLMPWSLPG PHPCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR Click to Show/Hide
|
|||||
| Family | Paired homeobox family |
|||||
| Function |
Growth factor active in angiogenesis, vasculogenesis and endothelial cell growth. Induces endothelial cell proliferation, promotes cell migration, inhibits apoptosis and induces permeabilization of blood vessels. Binds to the FLT1/VEGFR1 and KDR/VEGFR2 receptors, heparan sulfate and heparin. NRP1/Neuropilin-1 binds isoforms VEGF-165 and VEGF-145. Isoform VEGF165B binds to KDR but does not activate downstream signaling pathways, does not activate angiogenesis and inhibits tumor growth. Binding to NRP1 receptor initiates a signaling pathway needed for motor neuron axon guidance and cell body migration, including for the caudal migration of facial motor neurons from rhombomere 4 to rhombomere 6 during embryonic development. Also binds the DEAR/FBXW7-AS1 receptor.
Click to Show/Hide
|
|||||
| Uniprot Entry | ||||||
| HGNC ID | ||||||
| KEGG ID | ||||||
Each Antibody-drug Conjuate AND It's Component Related to This Antigen
Full List of The ADC Related to This Antigen
Bevacizumab
| ADC Info | ADC Name | Payload | Target | Linker | Ref |
|---|---|---|---|---|---|
AB-160 |
Paclitaxel |
Microtubule (MT) |
Undisclosed |
[1] | |
Bevacizumab vedotin |
Monomethyl auristatin E |
Microtubule (MT) |
Mc-Val-Cit-PABC |
[2] | |
Bevacizumab-Compound 17 |
Mertansine DM4 |
Microtubule (MT) |
Bevacizumab-Compound 17 linker |
[3] | |
Bevacizumab-Compound 25 |
Monomethyl auristatin E |
Microtubule (MT) |
Bevacizumab-Compound 25 linker |
[3] | |
Bevacizumab-Compound 31 |
Auristatin 0101 |
Microtubule (MT) |
Bevacizumab-Compound 31 linker |
[3] | |
Bevacizumab-Compound 36 |
Monomethyl auristatin E |
Microtubule (MT) |
Bevacizumab-Compound 36 linker |
[3] | |
Bevacizumab-Compound 43 |
PBD dimer |
Human Deoxyribonucleic acid (hDNA) |
Bevacizumab-Compound 43 linker |
[3] | |
Bevacizumab-Compound 49 |
PBD dimer |
Human Deoxyribonucleic acid (hDNA) |
Bevacizumab-Compound 49 linker |
[3] | |
Bevacizumab-Compound 55 |
Mertansine DM1 |
Microtubule (MT) |
Bevacizumab-Compound 55 linker |
[3] | |
Bevacizumab-Compound 59 |
Mertansine DM4 |
Microtubule (MT) |
Bevacizumab-Compound 59 linker |
[3] | |
Bevacizumab-Compound 64 |
Monomethyl auristatin E |
Microtubule (MT) |
Bevacizumab-Compound 64 linker |
[3] | |
Bevacizumab-Compound 69 |
Monomethyl auristatin E |
Microtubule (MT) |
Bevacizumab-Compound 69 linker |
[3] | |
Bevacizumab-Compound 74 |
PBD dimer |
Human Deoxyribonucleic acid (hDNA) |
Bevacizumab-Compound 74 linker |
[3] | |
Bevacizumab-Compound 75 |
Monomethyl auristatin E |
Microtubule (MT) |
Bevacizumab-Compound 75 linker |
[3] | |
Bevacizumab-Compound 76 |
Monomethyl auristatin E |
Microtubule (MT) |
Bevacizumab-Compound 76 linker |
[3] | |
Bevacizumab-Compound 77 |
Mertansine DM1 |
Microtubule (MT) |
Bevacizumab-Compound 77 linker |
[3] | |
Bevacizumab-Compound 78 |
Auristatin 0101 |
Microtubule (MT) |
Bevacizumab-Compound 78 linker |
[3] | |
Bevacizumab-Compound 79 |
Auristatin 0101 |
Microtubule (MT) |
Bevacizumab-Compound 79 linker |
[3] | |
Bevacizumab-Compound 80 |
Mertansine DM4 |
Microtubule (MT) |
Bevacizumab-Compound 80 linker |
[3] | |
Bevacizumab-Compound 9 |
Mertansine DM1 |
Microtubule (MT) |
Bevacizumab-Compound 9 linker |
[3] |
Undisclosed
| ADC Info | ADC Name | Payload | Target | Linker | Ref |
|---|---|---|---|---|---|
CBT-005 |
Undisclosed |
Undisclosed |
Undisclosed |
[4] | |
KSI-601 |
Undisclosed |
Undisclosed |
Undisclosed |
[5] |
Tissue/Disease specific Abundances of This Antigen
Tissue specific Abundances of This Antigen
ICD Disease Classification 01
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Gingival | |
| The Specific Disease | Bacterial infection of gingival | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 6.22E-08; Fold-change: 0.236389279; Z-score: 0.744848456 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
ICD Disease Classification 02
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Brainstem | |
| The Specific Disease | Glioma | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 8.96E-06; Fold-change: 2.337118503; Z-score: 10.70592368 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
| The Studied Tissue | White matter | |
| The Specific Disease | Glioma | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.00062991; Fold-change: 0.794946936; Z-score: 1.575050461 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
| The Studied Tissue | Brainstem | |
| The Specific Disease | Neuroectodermal tumor | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.407416123; Fold-change: -0.282476943; Z-score: -0.648521167 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
| The Studied Tissue | Nervous | |
| The Specific Disease | Brain cancer | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 3.33E-36; Fold-change: 0.271721681; Z-score: 0.428113197 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Whole blood | |
| The Specific Disease | Polycythemia vera | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.003199044; Fold-change: 0.208697111; Z-score: 1.069110688 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
| The Studied Tissue | Whole blood | |
| The Specific Disease | Myelofibrosis | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.019677762; Fold-change: 0.381111821; Z-score: 2.079043617 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Bone marrow | |
| The Specific Disease | Myelodysplastic syndromes | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.346312776; Fold-change: 0.32512876; Z-score: 0.481194599 | |
| The Expression Level of Disease Section Compare with the Adjacent Tissue | p-value: 0.096445938; Fold-change: 0.865393004; Z-score: 1.840320543 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Tonsil | |
| The Specific Disease | Lymphoma | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.314921425; Fold-change: 0.015877751; Z-score: 0.037889362 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Gastric | |
| The Specific Disease | Gastric cancer | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.163795164; Fold-change: -0.548018067; Z-score: -1.453255257 | |
| The Expression Level of Disease Section Compare with the Adjacent Tissue | p-value: 0.268566097; Fold-change: 0.041884654; Z-score: 0.114452358 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Colon | |
| The Specific Disease | Colon cancer | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 6.68E-49; Fold-change: 0.799458842; Z-score: 1.752446686 | |
| The Expression Level of Disease Section Compare with the Adjacent Tissue | p-value: 1.83E-43; Fold-change: 1.306631312; Z-score: 1.907329232 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Pancreas | |
| The Specific Disease | Pancreatic cancer | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.013030223; Fold-change: 0.346573489; Z-score: 0.543301049 | |
| The Expression Level of Disease Section Compare with the Adjacent Tissue | p-value: 0.077418953; Fold-change: 0.175127411; Z-score: 0.300591063 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Liver | |
| The Specific Disease | Liver cancer | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.887336868; Fold-change: 0.132260387; Z-score: 0.178269486 | |
| The Expression Level of Disease Section Compare with the Adjacent Tissue | p-value: 8.75E-08; Fold-change: 0.522506015; Z-score: 0.816426046 | |
| The Expression Level of Disease Section Compare with the Other Disease Section | p-value: 0.527556019; Fold-change: -0.140946561; Z-score: -0.333775963 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Lung | |
| The Specific Disease | Lung cancer | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.549129515; Fold-change: 0.037572086; Z-score: 0.062489219 | |
| The Expression Level of Disease Section Compare with the Adjacent Tissue | p-value: 0.011284551; Fold-change: -0.25078226; Z-score: -0.307699903 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Skin | |
| The Specific Disease | Melanoma | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.307872003; Fold-change: 0.111189752; Z-score: 0.181656264 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Muscle | |
| The Specific Disease | Sarcoma | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.065518079; Fold-change: -0.115578176; Z-score: -0.136657042 | |
| The Expression Level of Disease Section Compare with the Adjacent Tissue | p-value: 4.31E-05; Fold-change: 0.334250301; Z-score: 2.728856643 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Breast | |
| The Specific Disease | Breast cancer | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 6.44E-56; Fold-change: 0.657507264; Z-score: 1.008789092 | |
| The Expression Level of Disease Section Compare with the Adjacent Tissue | p-value: 1.24E-11; Fold-change: 0.513016502; Z-score: 0.933977408 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Ovarian | |
| The Specific Disease | Ovarian cancer | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.000248399; Fold-change: 1.321926839; Z-score: 1.657920497 | |
| The Expression Level of Disease Section Compare with the Adjacent Tissue | p-value: 0.009202782; Fold-change: 1.840869056; Z-score: 1.318884712 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Cervical | |
| The Specific Disease | Cervical cancer | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 5.30E-05; Fold-change: 0.242704043; Z-score: 0.706940046 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Endometrium | |
| The Specific Disease | Uterine cancer | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.000513165; Fold-change: 0.510183901; Z-score: 0.615851945 | |
| The Expression Level of Disease Section Compare with the Adjacent Tissue | p-value: 0.115549347; Fold-change: -0.186787245; Z-score: -0.456326102 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Prostate | |
| The Specific Disease | Prostate cancer | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.002125474; Fold-change: -1.345364499; Z-score: -1.149702119 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Bladder | |
| The Specific Disease | Bladder cancer | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 4.33E-06; Fold-change: 1.024064898; Z-score: 3.226189802 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Uvea | |
| The Specific Disease | Retinoblastoma tumor | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 8.99E-10; Fold-change: -2.176107214; Z-score: -3.441240863 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Thyroid | |
| The Specific Disease | Thyroid cancer | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 4.90E-05; Fold-change: -0.382352964; Z-score: -0.487277985 | |
| The Expression Level of Disease Section Compare with the Adjacent Tissue | p-value: 4.50E-12; Fold-change: -0.900913838; Z-score: -1.329733035 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Adrenal cortex | |
| The Specific Disease | Adrenocortical carcinoma | |
| The Expression Level of Disease Section Compare with the Other Disease Section | p-value: 0.120291864; Fold-change: 0.303595349; Z-score: 0.431087699 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Head and neck | |
| The Specific Disease | Head and neck cancer | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 2.40E-12; Fold-change: 0.583516911; Z-score: 1.129407567 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Pituitary | |
| The Specific Disease | Pituitary gonadotrope tumor | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.951219712; Fold-change: 0.16886877; Z-score: 0.234950823 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
| The Studied Tissue | Pituitary | |
| The Specific Disease | Pituitary cancer | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.044670825; Fold-change: 0.332095218; Z-score: 0.526928039 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
ICD Disease Classification 03
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Whole blood | |
| The Specific Disease | Thrombocytopenia | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.067193035; Fold-change: 0.412994694; Z-score: 0.826419196 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
ICD Disease Classification 04
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Whole blood | |
| The Specific Disease | Lupus erythematosus | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.471887299; Fold-change: 0.068078754; Z-score: 0.115868758 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Peripheral monocyte | |
| The Specific Disease | Autoimmune uveitis | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.619851531; Fold-change: -0.688838433; Z-score: -0.521062496 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
ICD Disease Classification 05
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Whole blood | |
| The Specific Disease | Familial hypercholesterolemia | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 2.85E-05; Fold-change: 0.653920603; Z-score: 1.792002847 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
ICD Disease Classification 06
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Superior temporal cortex | |
| The Specific Disease | Schizophrenia | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.508547969; Fold-change: 0.237153615; Z-score: 0.575140166 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
ICD Disease Classification 08
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Spinal cord | |
| The Specific Disease | Multiple sclerosis | |
| The Expression Level of Disease Section Compare with the Adjacent Tissue | p-value: 0.590265197; Fold-change: 0.274099678; Z-score: 0.364310245 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
| The Studied Tissue | Plasmacytoid dendritic cells | |
| The Specific Disease | Multiple sclerosis | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.037080357; Fold-change: 0.255276489; Z-score: 0.894003094 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Peritumoral cortex | |
| The Specific Disease | Epilepsy | |
| The Expression Level of Disease Section Compare with the Other Disease Section | p-value: 0.260394368; Fold-change: -0.264540849; Z-score: -0.40177057 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Whole blood | |
| The Specific Disease | Cardioembolic Stroke | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.195052334; Fold-change: 0.088338538; Z-score: 0.423847212 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
| The Studied Tissue | Peripheral blood | |
| The Specific Disease | Ischemic stroke | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.511541168; Fold-change: 0.092657204; Z-score: 0.181019564 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
ICD Disease Classification 1
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | White matter | |
| The Specific Disease | HIV | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.036188904; Fold-change: -0.185917049; Z-score: -0.666105057 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Whole blood | |
| The Specific Disease | Influenza | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.344318969; Fold-change: 0.002719986; Z-score: 0.009934658 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Whole blood | |
| The Specific Disease | Chronic hepatitis C | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.612572916; Fold-change: -0.098650361; Z-score: -0.095932139 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Whole blood | |
| The Specific Disease | Sepsis | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 5.52E-18; Fold-change: 0.425525148; Z-score: 1.448297311 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Whole blood | |
| The Specific Disease | Septic shock | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 4.46E-20; Fold-change: 0.278934017; Z-score: 1.032188005 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Peripheral blood | |
| The Specific Disease | Pediatric respiratory syncytial virus infection | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.311372258; Fold-change: 0.027104653; Z-score: 0.059774292 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
ICD Disease Classification 11
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Peripheral blood | |
| The Specific Disease | Essential hypertension | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.396173053; Fold-change: -0.090491552; Z-score: -3.412350739 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Peripheral blood | |
| The Specific Disease | Myocardial infarction | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 4.65E-06; Fold-change: 0.413067409; Z-score: 0.67610422 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Peripheral blood | |
| The Specific Disease | Coronary artery disease | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.323224516; Fold-change: -0.109625001; Z-score: -0.701104154 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Calcified aortic valve | |
| The Specific Disease | Aortic stenosis | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.696011415; Fold-change: 0.290967506; Z-score: 0.467304667 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Peripheral blood | |
| The Specific Disease | Arteriosclerosis | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.569369337; Fold-change: -0.011568541; Z-score: -0.087307938 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Intracranial artery | |
| The Specific Disease | Aneurysm | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.984666468; Fold-change: -0.125274363; Z-score: -0.207569454 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
ICD Disease Classification 12
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Peripheral blood | |
| The Specific Disease | Immunodeficiency | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.158474214; Fold-change: 0.075112656; Z-score: 0.783691609 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Hyperplastic tonsil | |
| The Specific Disease | Apnea | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.862166308; Fold-change: 0.049629403; Z-score: 0.275526117 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Peripheral blood | |
| The Specific Disease | Olive pollen allergy | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.651788699; Fold-change: -0.284079114; Z-score: -0.683972699 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Sinus mucosa | |
| The Specific Disease | Chronic rhinosinusitis | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.042150522; Fold-change: -0.788206884; Z-score: -1.47378589 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Lung | |
| The Specific Disease | Chronic obstructive pulmonary disease | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.973157902; Fold-change: -0.03845607; Z-score: -0.075914012 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
| The Studied Tissue | Small airway epithelium | |
| The Specific Disease | Chronic obstructive pulmonary disease | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.000253543; Fold-change: -0.247059897; Z-score: -0.434543714 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Nasal and bronchial airway | |
| The Specific Disease | Asthma | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 1.34E-05; Fold-change: -0.240198441; Z-score: -0.267324932 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Nasal Epithelium | |
| The Specific Disease | Human rhinovirus infection | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.107148959; Fold-change: 0.191632361; Z-score: 0.500775344 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Lung | |
| The Specific Disease | Idiopathic pulmonary fibrosis | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.21257548; Fold-change: -0.266370368; Z-score: -0.759989765 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
ICD Disease Classification 13
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Gingival | |
| The Specific Disease | Periodontal disease | |
| The Expression Level of Disease Section Compare with the Adjacent Tissue | p-value: 1.95E-08; Fold-change: 0.34968069; Z-score: 1.036239293 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Gastric antrum | |
| The Specific Disease | Eosinophilic gastritis | |
| The Expression Level of Disease Section Compare with the Adjacent Tissue | p-value: 0.26168819; Fold-change: -0.138459226; Z-score: -0.359019754 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Liver | |
| The Specific Disease | Liver failure | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 3.31E-05; Fold-change: -0.920286053; Z-score: -2.376352563 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Colon mucosal | |
| The Specific Disease | Ulcerative colitis | |
| The Expression Level of Disease Section Compare with the Adjacent Tissue | p-value: 0.019403725; Fold-change: 0.00984252; Z-score: 0.042836378 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Rectal colon | |
| The Specific Disease | Irritable bowel syndrome | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.035179667; Fold-change: 0.018492253; Z-score: 0.056805859 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
ICD Disease Classification 14
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Skin | |
| The Specific Disease | Atopic dermatitis | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.002738388; Fold-change: 0.083085885; Z-score: 0.411209672 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Skin | |
| The Specific Disease | Psoriasis | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.478438207; Fold-change: 0.218029021; Z-score: 0.299238459 | |
| The Expression Level of Disease Section Compare with the Adjacent Tissue | p-value: 1.61E-13; Fold-change: 0.387921566; Z-score: 1.118317389 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Skin | |
| The Specific Disease | Vitiligo | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.044644303; Fold-change: 0.278345017; Z-score: 1.272069762 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Skin from scalp | |
| The Specific Disease | Alopecia | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.103414713; Fold-change: -0.03277138; Z-score: -0.121644402 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Skin | |
| The Specific Disease | Sensitive skin | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.944496156; Fold-change: 0.0568363; Z-score: 0.264404609 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
ICD Disease Classification 15
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Synovial | |
| The Specific Disease | Osteoarthritis | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.521052251; Fold-change: 0.625026937; Z-score: 0.638495234 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Peripheral blood | |
| The Specific Disease | Arthropathy | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.015970191; Fold-change: 0.164337662; Z-score: 1.091423431 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Peripheral blood | |
| The Specific Disease | Arthritis | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 8.15E-08; Fold-change: 0.166060074; Z-score: 0.680744187 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Synovial | |
| The Specific Disease | Rheumatoid arthritis | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 1.82E-08; Fold-change: 1.02040792; Z-score: 4.988062723 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Pheripheral blood | |
| The Specific Disease | Ankylosing spondylitis | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.068421009; Fold-change: -0.23619217; Z-score: -0.637874634 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Bone marrow | |
| The Specific Disease | Osteoporosis | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.028210658; Fold-change: 1.352285924; Z-score: 1.838948358 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
ICD Disease Classification 16
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Endometrium | |
| The Specific Disease | Endometriosis | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.833559331; Fold-change: 0.127646343; Z-score: 0.214882748 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Bladder | |
| The Specific Disease | Interstitial cystitis | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.689876991; Fold-change: 0.215485762; Z-score: 0.652023458 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
ICD Disease Classification 19
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Myometrium | |
| The Specific Disease | Preterm birth | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.35135838; Fold-change: -0.520009437; Z-score: -0.689329471 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
ICD Disease Classification 2
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Bone marrow | |
| The Specific Disease | Acute myelocytic leukemia | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 5.11E-10; Fold-change: -0.392971367; Z-score: -0.72903932 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Bone marrow | |
| The Specific Disease | Myeloma | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.642931438; Fold-change: -0.094687235; Z-score: -0.342289312 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
| The Studied Tissue | Peripheral blood | |
| The Specific Disease | Myeloma | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.678048166; Fold-change: 0.152218421; Z-score: 0.364818829 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Oral | |
| The Specific Disease | Oral cancer | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.776056159; Fold-change: -0.174499827; Z-score: -0.252720328 | |
| The Expression Level of Disease Section Compare with the Adjacent Tissue | p-value: 0.018227244; Fold-change: 0.037634445; Z-score: 0.064014971 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Esophagus | |
| The Specific Disease | Esophagal cancer | |
| The Expression Level of Disease Section Compare with the Adjacent Tissue | p-value: 0.080088681; Fold-change: -0.97345695; Z-score: -1.28458169 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Rectal colon | |
| The Specific Disease | Rectal cancer | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.002067504; Fold-change: 1.198790416; Z-score: 2.264569689 | |
| The Expression Level of Disease Section Compare with the Adjacent Tissue | p-value: 1.28E-05; Fold-change: 0.970968935; Z-score: 4.059253689 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Skin | |
| The Specific Disease | Skin cancer | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.024042697; Fold-change: 0.032971363; Z-score: 0.058332505 | |
| The Expression Level of Disease Section Compare with the Adjacent Tissue | p-value: 2.75E-13; Fold-change: 0.275335847; Z-score: 0.828627555 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Kidney | |
| The Specific Disease | Renal cancer | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 2.39E-06; Fold-change: 1.399589921; Z-score: 2.936940513 | |
| The Expression Level of Disease Section Compare with the Adjacent Tissue | p-value: 1.56E-05; Fold-change: 0.842332079; Z-score: 0.862436827 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Urothelium | |
| The Specific Disease | Ureter cancer | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.238312629; Fold-change: 0.126186404; Z-score: 0.297455084 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
ICD Disease Classification 20
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Adipose | |
| The Specific Disease | Simpson golabi behmel syndrome | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 1.71E-05; Fold-change: 1.81524977; Z-score: 12.05227003 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Perituberal | |
| The Specific Disease | Tuberous sclerosis complex | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.07951785; Fold-change: -0.134107589; Z-score: -1.091404943 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
ICD Disease Classification 3
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Bone marrow | |
| The Specific Disease | Anemia | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.766795478; Fold-change: 0.107791308; Z-score: 0.698179588 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Peripheral blood | |
| The Specific Disease | Sickle cell disease | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.491808007; Fold-change: -0.011051144; Z-score: -0.052275311 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Whole blood | |
| The Specific Disease | Thrombocythemia | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.499223583; Fold-change: 0.072350101; Z-score: 0.379247804 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
ICD Disease Classification 4
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Whole blood | |
| The Specific Disease | Scleroderma | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.824459521; Fold-change: -0.03166149; Z-score: -0.189041917 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Salivary gland | |
| The Specific Disease | Sjogren syndrome | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.013936272; Fold-change: -0.188144418; Z-score: -2.40723673 | |
| The Expression Level of Disease Section Compare with the Adjacent Tissue | p-value: 0.791335417; Fold-change: 0.054763729; Z-score: 0.259789095 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Peripheral blood | |
| The Specific Disease | Behcet disease | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.97809636; Fold-change: -0.045300587; Z-score: -0.183431337 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Whole blood | |
| The Specific Disease | Autosomal dominant monocytopenia | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.253476499; Fold-change: 2.744165089; Z-score: 1.672478999 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
ICD Disease Classification 5
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Liver | |
| The Specific Disease | Type 2 diabetes | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.836914765; Fold-change: -0.124707056; Z-score: -0.41782675 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Vastus lateralis muscle | |
| The Specific Disease | Polycystic ovary syndrome | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.78886112; Fold-change: 0.036815983; Z-score: 0.210957788 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Subcutaneous Adipose | |
| The Specific Disease | Obesity | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.017727341; Fold-change: -0.154115776; Z-score: -0.472180369 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Biceps muscle | |
| The Specific Disease | Pompe disease | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.273114123; Fold-change: 0.134480276; Z-score: 0.306512412 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Whole blood | |
| The Specific Disease | Batten disease | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.291412305; Fold-change: 0.049319586; Z-score: 0.203519363 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
ICD Disease Classification 6
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Whole blood | |
| The Specific Disease | Autism | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.677214643; Fold-change: -0.007265474; Z-score: -0.040162669 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Whole blood | |
| The Specific Disease | Anxiety disorder | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.070583975; Fold-change: 0.080388122; Z-score: 0.491769412 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
ICD Disease Classification 8
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Substantia nigra | |
| The Specific Disease | Parkinson disease | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.066529215; Fold-change: 0.178248415; Z-score: 0.430993867 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Whole blood | |
| The Specific Disease | Huntington disease | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.453782518; Fold-change: 0.02355557; Z-score: 0.058292545 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Entorhinal cortex | |
| The Specific Disease | Alzheimer disease | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.028441741; Fold-change: -0.144757196; Z-score: -0.23609311 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Whole blood | |
| The Specific Disease | Seizure | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.830315395; Fold-change: 0.054024698; Z-score: 0.353535679 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Skin | |
| The Specific Disease | Lateral sclerosis | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.001801889; Fold-change: -0.652957083; Z-score: -3.113154781 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
| The Studied Tissue | Cervical spinal cord | |
| The Specific Disease | Lateral sclerosis | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.360534745; Fold-change: 0.154746582; Z-score: 0.467634311 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Muscle | |
| The Specific Disease | Muscular atrophy | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.075650728; Fold-change: -0.695387317; Z-score: -0.703405057 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Muscle | |
| The Specific Disease | Myopathy | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.054330894; Fold-change: -0.504008546; Z-score: -1.132232347 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
References
