Antigen Information
General Information of This Antigen
| Antigen ID | TAR0VKDND |
|||||
|---|---|---|---|---|---|---|
| Antigen Name | Vascular endothelial growth factor A (VEGFA) |
|||||
| Gene Name | VEGFA |
|||||
| Synonym | VEGF; Vascular permeability factor |
|||||
| Sequence |
MNFLLSWVHWSLALLLYLHHAKWSQAAPMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVD
IFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEM SFLQHNKCECRPKKDRARQEKKSVRGKGKGQKRKRKKSRYKSWSVYVGARCCLMPWSLPG PHPCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR Click to Show/Hide
|
|||||
| Family | Paired homeobox family |
|||||
| Function |
Growth factor active in angiogenesis, vasculogenesis and endothelial cell growth. Induces endothelial cell proliferation, promotes cell migration, inhibits apoptosis and induces permeabilization of blood vessels. Binds to the FLT1/VEGFR1 and KDR/VEGFR2 receptors, heparan sulfate and heparin. NRP1/Neuropilin-1 binds isoforms VEGF-165 and VEGF-145. Isoform VEGF165B binds to KDR but does not activate downstream signaling pathways, does not activate angiogenesis and inhibits tumor growth. Binding to NRP1 receptor initiates a signaling pathway needed for motor neuron axon guidance and cell body migration, including for the caudal migration of facial motor neurons from rhombomere 4 to rhombomere 6 during embryonic development. Also binds the DEAR/FBXW7-AS1 receptor.
Click to Show/Hide
|
|||||
| Uniprot Entry | ||||||
| HGNC ID | ||||||
| KEGG ID | ||||||
Each Antibody-drug Conjuate AND It's Component Related to This Antigen
Full List of The ADC Related to This Antigen
Bevacizumab
| ADC Info | ADC Name | Payload | Target | Linker | Ref |
|---|---|---|---|---|---|
AB-160 |
Paclitaxel |
Undisclosed |
Undisclosed |
||
Bevacizumab vedotin |
Monomethyl auristatin E |
Microtubule (MT) |
Mc-Val-Cit-PABC |
[1] | |
Bevacizumab-Compound 9 |
Mertansine DM1 |
Microtubule (MT) |
Bevacizumab-Compound 9 linker |
[2] | |
Bevacizumab-Compound 17 |
Mertansine DM4 |
Microtubule (MT) |
Bevacizumab-Compound 17 linker |
[2] | |
Bevacizumab-Compound 25 |
Monomethyl auristatin E |
Microtubule (MT) |
Bevacizumab-Compound 25 linker |
[2] | |
Bevacizumab-Compound 31 |
Auristatin 0101 |
Microtubule (MT) |
Bevacizumab-Compound 31 linker |
[2] | |
Bevacizumab-Compound 36 |
Monomethyl auristatin E |
Microtubule (MT) |
Bevacizumab-Compound 36 linker |
[2] | |
Bevacizumab-Compound 43 |
PBD dimer |
Human Deoxyribonucleic acid (hDNA) |
Bevacizumab-Compound 43 linker |
[2] | |
Bevacizumab-Compound 49 |
PBD dimer |
Human Deoxyribonucleic acid (hDNA) |
Bevacizumab-Compound 49 linker |
[2] | |
Bevacizumab-Compound 55 |
Mertansine DM1 |
Microtubule (MT) |
Bevacizumab-Compound 55 linker |
[2] | |
Bevacizumab-Compound 59 |
Mertansine DM4 |
Microtubule (MT) |
Bevacizumab-Compound 59 linker |
[2] | |
Bevacizumab-Compound 64 |
Monomethyl auristatin E |
Microtubule (MT) |
Bevacizumab-Compound 64 linker |
[2] | |
Bevacizumab-Compound 69 |
Monomethyl auristatin E |
Microtubule (MT) |
Bevacizumab-Compound 69 linker |
[2] | |
Bevacizumab-Compound 74 |
PBD dimer |
Human Deoxyribonucleic acid (hDNA) |
Bevacizumab-Compound 74 linker |
[2] | |
Bevacizumab-Compound 75 |
Monomethyl auristatin E |
Microtubule (MT) |
Bevacizumab-Compound 75 linker |
[2] | |
Bevacizumab-Compound 76 |
Monomethyl auristatin E |
Microtubule (MT) |
Bevacizumab-Compound 76 linker |
[2] | |
Bevacizumab-Compound 77 |
Mertansine DM1 |
Microtubule (MT) |
Bevacizumab-Compound 77 linker |
[2] | |
Bevacizumab-Compound 78 |
Auristatin 0101 |
Microtubule (MT) |
Bevacizumab-Compound 78 linker |
[2] | |
Bevacizumab-Compound 79 |
Auristatin 0101 |
Microtubule (MT) |
Bevacizumab-Compound 79 linker |
[2] | |
Bevacizumab-Compound 80 |
Mertansine DM4 |
Microtubule (MT) |
Bevacizumab-Compound 80 linker |
[2] | |
36924655 ADC 32 |
Monomethyl auristatin E |
Undisclosed |
Undisclosed |
[3] | |
Bevacizumab-DOX-PDT-1 |
Doxorubicin; PDT |
Undisclosed |
Undisclosed |
[4] | |
Bevacizumab-DOX-PDT-2 |
Doxorubicin; PDT |
Undisclosed |
Undisclosed |
[4] | |
Bevacizumab fluoresceine 13 |
Fluoresceine 13 |
Undisclosed |
Undisclosed |
[5] |
mAb-D
| ADC Info | ADC Name | Payload | Target | Linker | Ref |
|---|---|---|---|---|---|
WO2024140927A1-ADC-F (DAR2) |
Active metabolite of irinotecan SN38 |
Undisclosed |
CL2A |
[6] | |
WO2024140927A1-ADC-G (DAR2) |
Doxorubicin |
Undisclosed |
Succinimidyl-4- (N-maleimidomethyl)cyclohexane-1-carboxylate (SMCC) |
[6] |
Undisclosed
| ADC Info | ADC Name | Payload | Target | Linker | Ref |
|---|---|---|---|---|---|
KSI-601 |
Undisclosed |
Undisclosed |
Undisclosed |
[7] | |
CBT-005 |
Undisclosed |
Undisclosed |
Undisclosed |
[8] |
References
