Antigen Information
General Information of This Antigen (ID: TAR0VKDND)
| Antigen Name | Vascular endothelial growth factor A (VEGFA) |
|||||
|---|---|---|---|---|---|---|
| Gene Name | VEGFA |
|||||
| Gene ID | ||||||
| Synonym | VEGF; Vascular permeability factor |
|||||
| Sequence |
MNFLLSWVHWSLALLLYLHHAKWSQAAPMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVD
IFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEM SFLQHNKCECRPKKDRARQEKKSVRGKGKGQKRKRKKSRYKSWSVYVGARCCLMPWSLPG PHPCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR Click to Show/Hide
|
|||||
| Family | Paired homeobox family |
|||||
| Function |
Growth factor active in angiogenesis, vasculogenesis and endothelial cell growth. Induces endothelial cell proliferation, promotes cell migration, inhibits apoptosis and induces permeabilization of blood vessels. Binds to the FLT1/VEGFR1 and KDR/VEGFR2 receptors, heparan sulfate and heparin. NRP1/Neuropilin-1 binds isoforms VEGF-165 and VEGF-145. Isoform VEGF165B binds to KDR but does not activate downstream signaling pathways, does not activate angiogenesis and inhibits tumor growth. Binding to NRP1 receptor initiates a signaling pathway needed for motor neuron axon guidance and cell body migration, including for the caudal migration of facial motor neurons from rhombomere 4 to rhombomere 6 during embryonic development. Also binds the DEAR/FBXW7-AS1 receptor.
Click to Show/Hide
|
|||||
| Uniprot Entry | ||||||
| HGNC ID | ||||||
| KEGG ID | ||||||
Each Antibody-drug Conjugate and Its Component Related to This Antigen
Full List of The ADC Related to This Antigen
| The Numbers of ADCs, Their Three Components, Payload Targets, and Corresponding Diseases for This Antigens | ||||
|---|---|---|---|---|
Bevacizumab
| ADC Name | Payload | Target | Linker | ADC Info |
|---|---|---|---|---|
|
AB-160
|
Paclitaxel |
Undisclosed |
Undisclosed |
|
|
Bevacizumab vedotin
[1]
|
Monomethyl auristatin E |
Microtubule (MT) |
Mc-Val-Cit-PABC |
|
|
Bevacizumab-Compound 9
[2]
|
Mertansine DM1 |
Microtubule (MT) |
Bevacizumab-Compound 9 linker |
|
|
Bevacizumab-Compound 17
[2]
|
Mertansine DM4 |
Microtubule (MT) |
Bevacizumab-Compound 17 linker |
|
|
Bevacizumab-Compound 25
[2]
|
Monomethyl auristatin E |
Microtubule (MT) |
Bevacizumab-Compound 25 linker |
|
|
Bevacizumab-Compound 31
[2]
|
Auristatin 0101 |
Microtubule (MT) |
Bevacizumab-Compound 31 linker |
|
|
Bevacizumab-Compound 36
[2]
|
Monomethyl auristatin E |
Microtubule (MT) |
Bevacizumab-Compound 36 linker |
|
|
Bevacizumab-Compound 43
[2]
|
PBD dimer |
Human Deoxyribonucleic acid (hDNA) |
Bevacizumab-Compound 43 linker |
|
|
Bevacizumab-Compound 49
[2]
|
PBD dimer |
Human Deoxyribonucleic acid (hDNA) |
Bevacizumab-Compound 49 linker |
|
|
Bevacizumab-Compound 55
[2]
|
Mertansine DM1 |
Microtubule (MT) |
Bevacizumab-Compound 55 linker |
|
|
Bevacizumab-Compound 59
[2]
|
Mertansine DM4 |
Microtubule (MT) |
Bevacizumab-Compound 59 linker |
|
|
Bevacizumab-Compound 64
[2]
|
Monomethyl auristatin E |
Microtubule (MT) |
Bevacizumab-Compound 64 linker |
|
|
Bevacizumab-Compound 69
[2]
|
Monomethyl auristatin E |
Microtubule (MT) |
Bevacizumab-Compound 69 linker |
|
|
Bevacizumab-Compound 74
[2]
|
PBD dimer |
Human Deoxyribonucleic acid (hDNA) |
Bevacizumab-Compound 74 linker |
|
|
Bevacizumab-Compound 75
[2]
|
Monomethyl auristatin E |
Microtubule (MT) |
Bevacizumab-Compound 75 linker |
|
|
Bevacizumab-Compound 76
[2]
|
Monomethyl auristatin E |
Microtubule (MT) |
Bevacizumab-Compound 76 linker |
|
|
Bevacizumab-Compound 77
[2]
|
Mertansine DM1 |
Microtubule (MT) |
Bevacizumab-Compound 77 linker |
|
|
Bevacizumab-Compound 78
[2]
|
Auristatin 0101 |
Microtubule (MT) |
Bevacizumab-Compound 78 linker |
|
|
Bevacizumab-Compound 79
[2]
|
Auristatin 0101 |
Microtubule (MT) |
Bevacizumab-Compound 79 linker |
|
|
Bevacizumab-Compound 80
[2]
|
Mertansine DM4 |
Microtubule (MT) |
Bevacizumab-Compound 80 linker |
|
|
36924655 ADC 32
[3]
|
Monomethyl auristatin E |
Microtubule (MT) |
Undisclosed |
|
|
Bevacizumab-DOX-PDT-1
[4]
|
Doxorubicin; PDT |
Undisclosed |
Undisclosed |
|
|
Bevacizumab-DOX-PDT-2
[4]
|
Doxorubicin; PDT |
Undisclosed |
Undisclosed |
|
|
Bevacizumab fluoresceine 13
[5]
|
Fluoresceine 13 |
Undisclosed |
Undisclosed |
mAb-D
| ADC Name | Payload | Target | Linker | ADC Info |
|---|---|---|---|---|
|
WO2024140927A1-ADC-F (DAR2)
[6]
|
Active metabolite of irinotecan SN38 |
DNA topoisomerase 1 (TOP1) |
CL2A |
|
|
WO2024140927A1-ADC-G (DAR2)
[6]
|
Doxorubicin |
DNA topoisomerase 2-alpha (TOP2A) |
Succinimidyl-4- (N-maleimidomethyl)cyclohexane-1-carboxylate (SMCC) |
Undisclosed
| ADC Name | Payload | Target | Linker | ADC Info |
|---|---|---|---|---|
|
KSI-601
[7]
|
Undisclosed |
Undisclosed |
Undisclosed |
|
|
CBT-005
[8]
|
Undisclosed |
Undisclosed |
Undisclosed |
References
