Antigen Information
General Information of This Antigen (ID: TAR0UBWTY)
| Antigen Name | Translocator protein (TSPO) |
|||||
|---|---|---|---|---|---|---|
| Gene Name | TSPO |
|||||
| Gene ID | ||||||
| Synonym | BZRP; MBR; Mitochondrial benzodiazepine receptor; PKBS; Peripheral-type benzodiazepine receptor |
|||||
| Sequence |
MAPPWVPAMGFTLAPSLGCFVGSRFVHGEGLRWYAGLQKPSWHPPHWVLGPVWGTLYSAM
GYGSYLVWKELGGFTEKAVVPLGLYTGQLALNWAWPPIFFGARQMGWALVDLLLVSGAAA ATTVAWYQVSPLAARLLYPYLAWLAFTTTLNYCVWRDNHGWRGGRRLPE Click to Show/Hide
|
|||||
| Family | TspO/BZRP family |
|||||
| Function |
Can bind protoporphyrin IX and may play a role in the transport of porphyrins and heme. Promotes the transport of cholesterol across mitochondrial membranes and may play a role in lipid metabolism, but its precise physiological role is controversial. It is apparently not required for steroid hormone biosynthesis. Was initially identified as peripheral- type benzodiazepine receptor; can also bind isoquinoline carboxamides.
Click to Show/Hide
|
|||||
| Uniprot Entry | ||||||
| HGNC ID | ||||||
| KEGG ID | ||||||
Each Antibody-drug Conjugate and Its Component Related to This Antigen
Full List of The ADC Related to This Antigen
| The Numbers of ADCs, Their Three Components, Payload Targets, and Corresponding Diseases for This Antigens | ||||
|---|---|---|---|---|
Anti-SAIL mAb
| ADC Name | Payload | Target | Linker | ADC Info |
|---|---|---|---|---|
|
IGN-786
[1]
|
Monomethyl auristatin F |
Microtubule (MT) |
Maleimido-caproyl |
