General Information of This Antigen
Antigen ID
TAR0RPVKX
Antigen Name
CD59 glycoprotein (CD59)
Gene Name
CD59
Gene ID
966
Synonym
MIC11; MIN1; MIN2; MIN3; MSK21; 1F5 antigen; 20 kDa homologous restriction factor; MAC-inhibitory protein; MEM43 antigen; Membrane attack complex inhibition factor; Membrane inhibitor of reactive lysis; Protectin; CD_antigen=CD59
Sequence
MGIQGGSVLFGLLLVLAVFCHSGHSLQCYNCPNPTADCKTAVNCSSDFDACLITKAGLQV
YNKCWKFEHCNFNDVTTRLRENELTYYCCKKDLCNFNEQLENGGTSLSEKTVLLLVTPFL
AAAWSLHP

    Click to Show/Hide
Function
Potent inhibitor of the complement membrane attack complex (MAC) action. Acts by binding to the C8 and/or C9 complements of the assembling MAC, thereby preventing incorporation of the multiple copies of C9 required for complete formation of the osmolytic pore. This inhibitor appears to be species-specific. Involved in signal transduction for T-cell activation complexed to a protein tyrosine kinase.; The soluble form from urine retains its specific complement binding activity, but exhibits greatly reduced ability to inhibit MAC assembly on cell membranes.

    Click to Show/Hide
Uniprot Entry
CD59_HUMAN
HGNC ID
HGNC:1689
KEGG ID
hsa:966
Each Antibody-drug Conjuate AND It's Component Related to This Antigen
Full List of The ADC Related to This Antigen
Anti-CD59 mAb
ADC Info ADC Name Payload Target Linker Ref
Anti-CD59 mAb-Compound 17
Mertansine DM4
Microtubule (MT)
Anti-CD59 mAb-Compound 17 linker
[1]
Anti-CD59 mAb-Compound 25
Monomethyl auristatin E
Microtubule (MT)
Anti-CD59 mAb-Compound 25 linker
[1]
Anti-CD59 mAb-Compound 31
Auristatin 0101
Microtubule (MT)
Anti-CD59 mAb-Compound 31 linker
[1]
Anti-CD59 mAb-Compound 36
Monomethyl auristatin E
Microtubule (MT)
Anti-CD59 mAb-Compound 36 linker
[1]
Anti-CD59 mAb-Compound 43
PBD dimer
Human Deoxyribonucleic acid (hDNA)
Anti-CD59 mAb-Compound 43 linker
[1]
Anti-CD59 mAb-Compound 49
PBD dimer
Human Deoxyribonucleic acid (hDNA)
Anti-CD59 mAb-Compound 49 linker
[1]
Anti-CD59 mAb-Compound 55
Mertansine DM1
Microtubule (MT)
Anti-CD59 mAb-Compound 55 linker
[1]
Anti-CD59 mAb-Compound 59
Mertansine DM4
Microtubule (MT)
Anti-CD59 mAb-Compound 59 linker
[1]
Anti-CD59 mAb-Compound 64
Monomethyl auristatin E
Microtubule (MT)
Anti-CD59 mAb-Compound 64 linker
[1]
Anti-CD59 mAb-Compound 69
Monomethyl auristatin E
Microtubule (MT)
Anti-CD59 mAb-Compound 69 linker
[1]
Anti-CD59 mAb-Compound 74
PBD dimer
Human Deoxyribonucleic acid (hDNA)
Anti-CD59 mAb-Compound 74 linker
[1]
Anti-CD59 mAb-Compound 75
Monomethyl auristatin E
Microtubule (MT)
Anti-CD59 mAb-Compound 75 linker
[1]
Anti-CD59 mAb-Compound 76
Monomethyl auristatin E
Microtubule (MT)
Anti-CD59 mAb-Compound 76 linker
[1]
Anti-CD59 mAb-Compound 77
Mertansine DM1
Microtubule (MT)
Anti-CD59 mAb-Compound 77 linker
[1]
Anti-CD59 mAb-Compound 78
Auristatin 0101
Microtubule (MT)
Anti-CD59 mAb-Compound 78 linker
[1]
Anti-CD59 mAb-Compound 79
Auristatin 0101
Microtubule (MT)
Anti-CD59 mAb-Compound 79 linker
[1]
Anti-CD59 mAb-Compound 80
Mertansine DM4
Microtubule (MT)
Anti-CD59 mAb-Compound 80 linker
[1]
Anti-CD59 mAb-Compound 9
Mertansine DM1
Microtubule (MT)
Anti-CD59 mAb-Compound 9 linker
[1]
References
Ref 1 Covalent linkers in antibody-drug conjugates and methods of making and using the same.