Antigen Information | ADCdb

General Information of This Antigen

Antigen ID	TAR0RPVKX
Antigen Name	CD59 glycoprotein (CD59)
Gene Name	CD59
Gene ID	966
Synonym	MIC11; MIN1; MIN2; MIN3; MSK21; 1F5 antigen; 20 kDa homologous restriction factor; MAC-inhibitory protein; MEM43 antigen; Membrane attack complex inhibition factor; Membrane inhibitor of reactive lysis; Protectin; CD_antigen=CD59
Sequence	MGIQGGSVLFGLLLVLAVFCHSGHSLQCYNCPNPTADCKTAVNCSSDFDACLITKAGLQV YNKCWKFEHCNFNDVTTRLRENELTYYCCKKDLCNFNEQLENGGTSLSEKTVLLLVTPFL AAAWSLHP Click to Show/Hide
Function	Potent inhibitor of the complement membrane attack complex (MAC) action. Acts by binding to the C8 and/or C9 complements of the assembling MAC, thereby preventing incorporation of the multiple copies of C9 required for complete formation of the osmolytic pore. This inhibitor appears to be species-specific. Involved in signal transduction for T-cell activation complexed to a protein tyrosine kinase.; The soluble form from urine retains its specific complement binding activity, but exhibits greatly reduced ability to inhibit MAC assembly on cell membranes. Click to Show/Hide
Uniprot Entry	CD59_HUMAN
HGNC ID	HGNC:1689
KEGG ID	hsa:966

Each Antibody-drug Conjuate AND It's Component Related to This Antigen

Full List of The ADC Related to This Antigen

Anti-CD59 mAb

Antibody Info

ADC Info	ADC Name	Payload	Target	Linker	Ref
ADC Info	Anti-CD59 mAb-Compound 9	Mertansine DM1	Microtubule (MT)	Anti-CD59 mAb-Compound 9 linker	[1]
ADC Info	Anti-CD59 mAb-Compound 17	Mertansine DM4	Microtubule (MT)	Anti-CD59 mAb-Compound 17 linker	[1]
ADC Info	Anti-CD59 mAb-Compound 25	Monomethyl auristatin E	Microtubule (MT)	Anti-CD59 mAb-Compound 25 linker	[1]
ADC Info	Anti-CD59 mAb-Compound 31	Auristatin 0101	Microtubule (MT)	Anti-CD59 mAb-Compound 31 linker	[1]
ADC Info	Anti-CD59 mAb-Compound 36	Monomethyl auristatin E	Microtubule (MT)	Anti-CD59 mAb-Compound 36 linker	[1]
ADC Info	Anti-CD59 mAb-Compound 43	PBD dimer	Human Deoxyribonucleic acid (hDNA)	Anti-CD59 mAb-Compound 43 linker	[1]
ADC Info	Anti-CD59 mAb-Compound 49	PBD dimer	Human Deoxyribonucleic acid (hDNA)	Anti-CD59 mAb-Compound 49 linker	[1]
ADC Info	Anti-CD59 mAb-Compound 55	Mertansine DM1	Microtubule (MT)	Anti-CD59 mAb-Compound 55 linker	[1]
ADC Info	Anti-CD59 mAb-Compound 59	Mertansine DM4	Microtubule (MT)	Anti-CD59 mAb-Compound 59 linker	[1]
ADC Info	Anti-CD59 mAb-Compound 64	Monomethyl auristatin E	Microtubule (MT)	Anti-CD59 mAb-Compound 64 linker	[1]
ADC Info	Anti-CD59 mAb-Compound 69	Monomethyl auristatin E	Microtubule (MT)	Anti-CD59 mAb-Compound 69 linker	[1]
ADC Info	Anti-CD59 mAb-Compound 74	PBD dimer	Human Deoxyribonucleic acid (hDNA)	Anti-CD59 mAb-Compound 74 linker	[1]
ADC Info	Anti-CD59 mAb-Compound 75	Monomethyl auristatin E	Microtubule (MT)	Anti-CD59 mAb-Compound 75 linker	[1]
ADC Info	Anti-CD59 mAb-Compound 76	Monomethyl auristatin E	Microtubule (MT)	Anti-CD59 mAb-Compound 76 linker	[1]
ADC Info	Anti-CD59 mAb-Compound 77	Mertansine DM1	Microtubule (MT)	Anti-CD59 mAb-Compound 77 linker	[1]
ADC Info	Anti-CD59 mAb-Compound 78	Auristatin 0101	Microtubule (MT)	Anti-CD59 mAb-Compound 78 linker	[1]
ADC Info	Anti-CD59 mAb-Compound 79	Auristatin 0101	Microtubule (MT)	Anti-CD59 mAb-Compound 79 linker	[1]
ADC Info	Anti-CD59 mAb-Compound 80	Mertansine DM4	Microtubule (MT)	Anti-CD59 mAb-Compound 80 linker	[1]

References

Ref 1	Covalent linkers in antibody-drug conjugates and methods of making and using the same.

If you find any error in data or bug in web service, please kindly report it to Dr. Shen et al.