Antigen Information
General Information of This Antigen (ID: TAR0RPVKX)
| Antigen Name | CD59 glycoprotein (CD59) |
|||||
|---|---|---|---|---|---|---|
| Gene Name | CD59 |
|||||
| Gene ID | ||||||
| Synonym | MIC11; MIN1; MIN2; MIN3; MSK21; 1F5 antigen; 20 kDa homologous restriction factor; MAC-inhibitory protein; MEM43 antigen; Membrane attack complex inhibition factor; Membrane inhibitor of reactive lysis; Protectin; CD59 |
|||||
| Sequence |
MGIQGGSVLFGLLLVLAVFCHSGHSLQCYNCPNPTADCKTAVNCSSDFDACLITKAGLQV
YNKCWKFEHCNFNDVTTRLRENELTYYCCKKDLCNFNEQLENGGTSLSEKTVLLLVTPFL AAAWSLHP Click to Show/Hide
|
|||||
| Function |
Potent inhibitor of the complement membrane attack complex (MAC) action. Acts by binding to the C8 and/or C9 complements of the assembling MAC, thereby preventing incorporation of the multiple copies of C9 required for complete formation of the osmolytic pore. This inhibitor appears to be species-specific. Involved in signal transduction for T-cell activation complexed to a protein tyrosine kinase.; The soluble form from urine retains its specific complement binding activity, but exhibits greatly reduced ability to inhibit MAC assembly on cell membranes.
Click to Show/Hide
|
|||||
| Uniprot Entry | ||||||
| HGNC ID | ||||||
| KEGG ID | ||||||
Each Antibody-drug Conjugate and Its Component Related to This Antigen
Full List of The ADC Related to This Antigen
| The Numbers of ADCs, Their Three Components, Payload Targets, and Corresponding Diseases for This Antigens | ||||
|---|---|---|---|---|
Anti-CD59 mAb
| ADC Name | Payload | Target | Linker | ADC Info |
|---|---|---|---|---|
|
Anti-CD59 mAb-Compound 9
[1]
|
Mertansine DM1 |
Microtubule (MT) |
Anti-CD59 mAb-Compound 9 linker |
|
|
Anti-CD59 mAb-Compound 17
[1]
|
Mertansine DM4 |
Microtubule (MT) |
Anti-CD59 mAb-Compound 17 linker |
|
|
Anti-CD59 mAb-Compound 25
[1]
|
Monomethyl auristatin E |
Microtubule (MT) |
Anti-CD59 mAb-Compound 25 linker |
|
|
Anti-CD59 mAb-Compound 31
[1]
|
Auristatin 0101 |
Microtubule (MT) |
Anti-CD59 mAb-Compound 31 linker |
|
|
Anti-CD59 mAb-Compound 36
[1]
|
Monomethyl auristatin E |
Microtubule (MT) |
Anti-CD59 mAb-Compound 36 linker |
|
|
Anti-CD59 mAb-Compound 43
[1]
|
PBD dimer |
Human Deoxyribonucleic acid (hDNA) |
Anti-CD59 mAb-Compound 43 linker |
|
|
Anti-CD59 mAb-Compound 49
[1]
|
PBD dimer |
Human Deoxyribonucleic acid (hDNA) |
Anti-CD59 mAb-Compound 49 linker |
|
|
Anti-CD59 mAb-Compound 55
[1]
|
Mertansine DM1 |
Microtubule (MT) |
Anti-CD59 mAb-Compound 55 linker |
|
|
Anti-CD59 mAb-Compound 59
[1]
|
Mertansine DM4 |
Microtubule (MT) |
Anti-CD59 mAb-Compound 59 linker |
|
|
Anti-CD59 mAb-Compound 64
[1]
|
Monomethyl auristatin E |
Microtubule (MT) |
Anti-CD59 mAb-Compound 64 linker |
|
|
Anti-CD59 mAb-Compound 69
[1]
|
Monomethyl auristatin E |
Microtubule (MT) |
Anti-CD59 mAb-Compound 69 linker |
|
|
Anti-CD59 mAb-Compound 74
[1]
|
PBD dimer |
Human Deoxyribonucleic acid (hDNA) |
Anti-CD59 mAb-Compound 74 linker |
|
|
Anti-CD59 mAb-Compound 75
[1]
|
Monomethyl auristatin E |
Microtubule (MT) |
Anti-CD59 mAb-Compound 75 linker |
|
|
Anti-CD59 mAb-Compound 76
[1]
|
Monomethyl auristatin E |
Microtubule (MT) |
Anti-CD59 mAb-Compound 76 linker |
|
|
Anti-CD59 mAb-Compound 77
[1]
|
Mertansine DM1 |
Microtubule (MT) |
Anti-CD59 mAb-Compound 77 linker |
|
|
Anti-CD59 mAb-Compound 78
[1]
|
Auristatin 0101 |
Microtubule (MT) |
Anti-CD59 mAb-Compound 78 linker |
|
|
Anti-CD59 mAb-Compound 79
[1]
|
Auristatin 0101 |
Microtubule (MT) |
Anti-CD59 mAb-Compound 79 linker |
|
|
Anti-CD59 mAb-Compound 80
[1]
|
Mertansine DM4 |
Microtubule (MT) |
Anti-CD59 mAb-Compound 80 linker |
References