Antigen Information
General Information of This Antigen
| Antigen ID | TAR0RPVKX |
|||||
|---|---|---|---|---|---|---|
| Antigen Name | CD59 glycoprotein (CD59) |
|||||
| Gene Name | CD59 |
|||||
| Gene ID | ||||||
| Synonym | MIC11; MIN1; MIN2; MIN3; MSK21; 1F5 antigen; 20 kDa homologous restriction factor; MAC-inhibitory protein; MEM43 antigen; Membrane attack complex inhibition factor; Membrane inhibitor of reactive lysis; Protectin; CD_antigen=CD59 |
|||||
| Sequence |
MGIQGGSVLFGLLLVLAVFCHSGHSLQCYNCPNPTADCKTAVNCSSDFDACLITKAGLQV
YNKCWKFEHCNFNDVTTRLRENELTYYCCKKDLCNFNEQLENGGTSLSEKTVLLLVTPFL AAAWSLHP Click to Show/Hide
|
|||||
| Function |
Potent inhibitor of the complement membrane attack complex (MAC) action. Acts by binding to the C8 and/or C9 complements of the assembling MAC, thereby preventing incorporation of the multiple copies of C9 required for complete formation of the osmolytic pore. This inhibitor appears to be species-specific. Involved in signal transduction for T-cell activation complexed to a protein tyrosine kinase.; The soluble form from urine retains its specific complement binding activity, but exhibits greatly reduced ability to inhibit MAC assembly on cell membranes.
Click to Show/Hide
|
|||||
| Uniprot Entry | ||||||
| HGNC ID | ||||||
| KEGG ID | ||||||
Each Antibody-drug Conjuate AND It's Component Related to This Antigen
Full List of The ADC Related to This Antigen
Anti-CD59 mAb
| ADC Info | ADC Name | Payload | Target | Linker | Ref |
|---|---|---|---|---|---|
Anti-CD59 mAb-Compound 9 |
Mertansine DM1 |
Microtubule (MT) |
Anti-CD59 mAb-Compound 9 linker |
[1] | |
Anti-CD59 mAb-Compound 17 |
Mertansine DM4 |
Microtubule (MT) |
Anti-CD59 mAb-Compound 17 linker |
[1] | |
Anti-CD59 mAb-Compound 25 |
Monomethyl auristatin E |
Microtubule (MT) |
Anti-CD59 mAb-Compound 25 linker |
[1] | |
Anti-CD59 mAb-Compound 31 |
Auristatin 0101 |
Microtubule (MT) |
Anti-CD59 mAb-Compound 31 linker |
[1] | |
Anti-CD59 mAb-Compound 36 |
Monomethyl auristatin E |
Microtubule (MT) |
Anti-CD59 mAb-Compound 36 linker |
[1] | |
Anti-CD59 mAb-Compound 43 |
PBD dimer |
Human Deoxyribonucleic acid (hDNA) |
Anti-CD59 mAb-Compound 43 linker |
[1] | |
Anti-CD59 mAb-Compound 49 |
PBD dimer |
Human Deoxyribonucleic acid (hDNA) |
Anti-CD59 mAb-Compound 49 linker |
[1] | |
Anti-CD59 mAb-Compound 55 |
Mertansine DM1 |
Microtubule (MT) |
Anti-CD59 mAb-Compound 55 linker |
[1] | |
Anti-CD59 mAb-Compound 59 |
Mertansine DM4 |
Microtubule (MT) |
Anti-CD59 mAb-Compound 59 linker |
[1] | |
Anti-CD59 mAb-Compound 64 |
Monomethyl auristatin E |
Microtubule (MT) |
Anti-CD59 mAb-Compound 64 linker |
[1] | |
Anti-CD59 mAb-Compound 69 |
Monomethyl auristatin E |
Microtubule (MT) |
Anti-CD59 mAb-Compound 69 linker |
[1] | |
Anti-CD59 mAb-Compound 74 |
PBD dimer |
Human Deoxyribonucleic acid (hDNA) |
Anti-CD59 mAb-Compound 74 linker |
[1] | |
Anti-CD59 mAb-Compound 75 |
Monomethyl auristatin E |
Microtubule (MT) |
Anti-CD59 mAb-Compound 75 linker |
[1] | |
Anti-CD59 mAb-Compound 76 |
Monomethyl auristatin E |
Microtubule (MT) |
Anti-CD59 mAb-Compound 76 linker |
[1] | |
Anti-CD59 mAb-Compound 77 |
Mertansine DM1 |
Microtubule (MT) |
Anti-CD59 mAb-Compound 77 linker |
[1] | |
Anti-CD59 mAb-Compound 78 |
Auristatin 0101 |
Microtubule (MT) |
Anti-CD59 mAb-Compound 78 linker |
[1] | |
Anti-CD59 mAb-Compound 79 |
Auristatin 0101 |
Microtubule (MT) |
Anti-CD59 mAb-Compound 79 linker |
[1] | |
Anti-CD59 mAb-Compound 80 |
Mertansine DM4 |
Microtubule (MT) |
Anti-CD59 mAb-Compound 80 linker |
[1] |
References
If you find any error in data or bug in web service, please kindly report it to Dr. Shen et al.
