Antigen Information
General Information of This Antigen
| Antigen ID | TAR0QVFKZ |
|||||
|---|---|---|---|---|---|---|
| Antigen Name | Male-specific lethal 1 homolog (MSL1) |
|||||
| Gene Name | MSL1 |
|||||
| Gene ID | ||||||
| Synonym | MSL1L1; Male-specific lethal 1-like 1; Male-specific lethal-1 homolog 1 |
|||||
| Sequence |
MTMRSAVFKAAAAPAGGNPEQRLDYERAAALGGPEDEPGAAEAHFLPRHRKLKEPGPPLA
SSQGGSPAPSPAGCGGKGRGLLLPAGAAPGQQEESWGGSVPLPCPPPATKQAGIGGEPAA AGAGCSPRPKYQAVLPIQTGSLVAAAKEPTPWAGDKGGAASPAATASDPAGPPPLPLPGP PPLAPTATAGTLAASEGRWKSMRKSPLGGGGGSGASSQAACLKQILLLQLDLIEQQQQQL QAKEKEIEELKSERDTLLARIERMERRMQLVKKDNEKERHKLFQGYETEEREETELSEKI KLECQPELSETSQTLPPKPFSCGRSGKGHKRKSPFGSTERKTPVKKLAPEFSKVKTKTPK HSPIKEEPCGSLSETVCKRELRSQETPEKPRSSVDTPPRLSTPQKGPSTHPKEKAFSSEI EDLPYLSTTEMYLCRWHQPPPSPLPLRESSPKKEETVARCLMPSSVAGETSVLAVPSWRD HSVEPLRDPNPSDLLENLDDSVFSKRHAKLELDEKRRKRWDIQRIREQRILQRLQLRMYK KKGIQESEPEVTSFFPEPDDVESLMITPFLPVVAFGRPLPKLTPQNFELPWLDERSRCRL EIQKKQTPHRTCRK Click to Show/Hide
|
|||||
| Family | Msl-1 family |
|||||
| Function |
Component of histone acetyltransferase complex responsible for the majority of histone H4 acetylation at 'Lys-16' (H4K16ac) which is implicated in the formation of higher-order chromatin structure. Greatly enhances MSL2 E3 ubiquitin ligase activity, promoting monoubiquitination of histone H2B at 'Lys-34' (H2BK34Ub). This modification in turn stimulates histone H3 methylation at 'Lys-4' (H3K4me) and 'Lys-79' (H3K79me) and leads to gene activation, including that of HOXA9 and MEIS1. In the MSL complex, acts as a scaffold to tether MSL3 and KAT8 together for enzymatic activity regulation.
Click to Show/Hide
|
|||||
| Uniprot Entry | ||||||
| HGNC ID | ||||||
| KEGG ID | ||||||
Each Antibody-drug Conjuate AND It's Component Related to This Antigen
Full List of The ADC Related to This Antigen
Anti-MSL1 mAb
| ADC Info | ADC Name | Payload | Target | Linker | Ref |
|---|---|---|---|---|---|
Anti-MSL1 mAb-Compound 9 |
Mertansine DM1 |
Microtubule (MT) |
Anti-MSL1 mAb-Compound 9 linker |
[1] | |
Anti-MSL1 mAb-Compound 17 |
Mertansine DM4 |
Microtubule (MT) |
Anti-MSL1 mAb-Compound 17 linker |
[1] | |
Anti-MSL1 mAb-Compound 25 |
Monomethyl auristatin E |
Microtubule (MT) |
Anti-MSL1 mAb-Compound 25 linker |
[1] | |
Anti-MSL1 mAb-Compound 31 |
Auristatin 0101 |
Microtubule (MT) |
Anti-MSL1 mAb-Compound 31 linker |
[1] | |
Anti-MSL1 mAb-Compound 36 |
Monomethyl auristatin E |
Microtubule (MT) |
Anti-MSL1 mAb-Compound 36 linker |
[1] | |
Anti-MSL1 mAb-Compound 43 |
PBD dimer |
Human Deoxyribonucleic acid (hDNA) |
Anti-MSL1 mAb-Compound 43 linker |
[1] | |
Anti-MSL1 mAb-Compound 49 |
PBD dimer |
Human Deoxyribonucleic acid (hDNA) |
Anti-MSL1 mAb-Compound 49 linker |
[1] | |
Anti-MSL1 mAb-Compound 55 |
Mertansine DM1 |
Microtubule (MT) |
Anti-MSL1 mAb-Compound 55 linker |
[1] | |
Anti-MSL1 mAb-Compound 59 |
Mertansine DM4 |
Microtubule (MT) |
Anti-MSL1 mAb-Compound 59 linker |
[1] | |
Anti-MSL1 mAb-Compound 64 |
Monomethyl auristatin E |
Microtubule (MT) |
Anti-MSL1 mAb-Compound 64 linker |
[1] | |
Anti-MSL1 mAb-Compound 69 |
Monomethyl auristatin E |
Microtubule (MT) |
Anti-MSL1 mAb-Compound 69 linker |
[1] | |
Anti-MSL1 mAb-Compound 74 |
PBD dimer |
Human Deoxyribonucleic acid (hDNA) |
Anti-MSL1 mAb-Compound 74 linker |
[1] | |
Anti-MSL1 mAb-Compound 75 |
Monomethyl auristatin E |
Microtubule (MT) |
Anti-MSL1 mAb-Compound 75 linker |
[1] | |
Anti-MSL1 mAb-Compound 76 |
Monomethyl auristatin E |
Microtubule (MT) |
Anti-MSL1 mAb-Compound 76 linker |
[1] | |
Anti-MSL1 mAb-Compound 77 |
Mertansine DM1 |
Microtubule (MT) |
Anti-MSL1 mAb-Compound 77 linker |
[1] | |
Anti-MSL1 mAb-Compound 78 |
Auristatin 0101 |
Microtubule (MT) |
Anti-MSL1 mAb-Compound 78 linker |
[1] | |
Anti-MSL1 mAb-Compound 79 |
Auristatin 0101 |
Microtubule (MT) |
Anti-MSL1 mAb-Compound 79 linker |
[1] | |
Anti-MSL1 mAb-Compound 80 |
Mertansine DM4 |
Microtubule (MT) |
Anti-MSL1 mAb-Compound 80 linker |
[1] |
References
If you find any error in data or bug in web service, please kindly report it to Dr. Shen et al.