Antigen Information
General Information of This Antigen (ID: TAR0QVFKZ)
| Antigen Name | Male-specific lethal 1 homolog (MSL1) |
|||||
|---|---|---|---|---|---|---|
| Gene Name | MSL1 |
|||||
| Gene ID | ||||||
| Synonym | MSL1L1; Male-specific lethal 1-like 1; Male-specific lethal-1 homolog 1 |
|||||
| Sequence |
MTMRSAVFKAAAAPAGGNPEQRLDYERAAALGGPEDEPGAAEAHFLPRHRKLKEPGPPLA
SSQGGSPAPSPAGCGGKGRGLLLPAGAAPGQQEESWGGSVPLPCPPPATKQAGIGGEPAA AGAGCSPRPKYQAVLPIQTGSLVAAAKEPTPWAGDKGGAASPAATASDPAGPPPLPLPGP PPLAPTATAGTLAASEGRWKSMRKSPLGGGGGSGASSQAACLKQILLLQLDLIEQQQQQL QAKEKEIEELKSERDTLLARIERMERRMQLVKKDNEKERHKLFQGYETEEREETELSEKI KLECQPELSETSQTLPPKPFSCGRSGKGHKRKSPFGSTERKTPVKKLAPEFSKVKTKTPK HSPIKEEPCGSLSETVCKRELRSQETPEKPRSSVDTPPRLSTPQKGPSTHPKEKAFSSEI EDLPYLSTTEMYLCRWHQPPPSPLPLRESSPKKEETVARCLMPSSVAGETSVLAVPSWRD HSVEPLRDPNPSDLLENLDDSVFSKRHAKLELDEKRRKRWDIQRIREQRILQRLQLRMYK KKGIQESEPEVTSFFPEPDDVESLMITPFLPVVAFGRPLPKLTPQNFELPWLDERSRCRL EIQKKQTPHRTCRK Click to Show/Hide
|
|||||
| Family | Msl-1 family |
|||||
| Function |
Component of histone acetyltransferase complex responsible for the majority of histone H4 acetylation at 'Lys-16' (H4K16ac) which is implicated in the formation of higher-order chromatin structure. Greatly enhances MSL2 E3 ubiquitin ligase activity, promoting monoubiquitination of histone H2B at 'Lys-34' (H2BK34Ub). This modification in turn stimulates histone H3 methylation at 'Lys-4' (H3K4me) and 'Lys-79' (H3K79me) and leads to gene activation, including that of HOXA9 and MEIS1. In the MSL complex, acts as a scaffold to tether MSL3 and KAT8 together for enzymatic activity regulation.
Click to Show/Hide
|
|||||
| Uniprot Entry | ||||||
| HGNC ID | ||||||
| KEGG ID | ||||||
Each Antibody-drug Conjugate and Its Component Related to This Antigen
Full List of The ADC Related to This Antigen
| The Numbers of ADCs, Their Three Components, Payload Targets, and Corresponding Diseases for This Antigens | ||||
|---|---|---|---|---|
Anti-MSL1 mAb
| ADC Name | Payload | Target | Linker | ADC Info |
|---|---|---|---|---|
|
Anti-MSL1 mAb-Compound 9
[1]
|
Mertansine DM1 |
Microtubule (MT) |
Anti-MSL1 mAb-Compound 9 linker |
|
|
Anti-MSL1 mAb-Compound 17
[1]
|
Mertansine DM4 |
Microtubule (MT) |
Anti-MSL1 mAb-Compound 17 linker |
|
|
Anti-MSL1 mAb-Compound 25
[1]
|
Monomethyl auristatin E |
Microtubule (MT) |
Anti-MSL1 mAb-Compound 25 linker |
|
|
Anti-MSL1 mAb-Compound 31
[1]
|
Auristatin 0101 |
Microtubule (MT) |
Anti-MSL1 mAb-Compound 31 linker |
|
|
Anti-MSL1 mAb-Compound 36
[1]
|
Monomethyl auristatin E |
Microtubule (MT) |
Anti-MSL1 mAb-Compound 36 linker |
|
|
Anti-MSL1 mAb-Compound 43
[1]
|
PBD dimer |
Human Deoxyribonucleic acid (hDNA) |
Anti-MSL1 mAb-Compound 43 linker |
|
|
Anti-MSL1 mAb-Compound 49
[1]
|
PBD dimer |
Human Deoxyribonucleic acid (hDNA) |
Anti-MSL1 mAb-Compound 49 linker |
|
|
Anti-MSL1 mAb-Compound 55
[1]
|
Mertansine DM1 |
Microtubule (MT) |
Anti-MSL1 mAb-Compound 55 linker |
|
|
Anti-MSL1 mAb-Compound 59
[1]
|
Mertansine DM4 |
Microtubule (MT) |
Anti-MSL1 mAb-Compound 59 linker |
|
|
Anti-MSL1 mAb-Compound 64
[1]
|
Monomethyl auristatin E |
Microtubule (MT) |
Anti-MSL1 mAb-Compound 64 linker |
|
|
Anti-MSL1 mAb-Compound 69
[1]
|
Monomethyl auristatin E |
Microtubule (MT) |
Anti-MSL1 mAb-Compound 69 linker |
|
|
Anti-MSL1 mAb-Compound 74
[1]
|
PBD dimer |
Human Deoxyribonucleic acid (hDNA) |
Anti-MSL1 mAb-Compound 74 linker |
|
|
Anti-MSL1 mAb-Compound 75
[1]
|
Monomethyl auristatin E |
Microtubule (MT) |
Anti-MSL1 mAb-Compound 75 linker |
|
|
Anti-MSL1 mAb-Compound 76
[1]
|
Monomethyl auristatin E |
Microtubule (MT) |
Anti-MSL1 mAb-Compound 76 linker |
|
|
Anti-MSL1 mAb-Compound 77
[1]
|
Mertansine DM1 |
Microtubule (MT) |
Anti-MSL1 mAb-Compound 77 linker |
|
|
Anti-MSL1 mAb-Compound 78
[1]
|
Auristatin 0101 |
Microtubule (MT) |
Anti-MSL1 mAb-Compound 78 linker |
|
|
Anti-MSL1 mAb-Compound 79
[1]
|
Auristatin 0101 |
Microtubule (MT) |
Anti-MSL1 mAb-Compound 79 linker |
|
|
Anti-MSL1 mAb-Compound 80
[1]
|
Mertansine DM4 |
Microtubule (MT) |
Anti-MSL1 mAb-Compound 80 linker |
References