Antigen Information
General Information of This Antigen
| Antigen ID | TAR0QHRAZ |
|||||
|---|---|---|---|---|---|---|
| Antigen Name | Leukocyte surface antigen CD47 (CD47) |
|||||
| Gene Name | CD47 |
|||||
| Synonym | MER6; Antigenic surface determinant protein OA3;Integrin-associated protein;Protein MER6;CD_antigen=CD47 |
|||||
| Sequence |
MWPLVAALLLGSACCGSAQLLFNKTKSVEFTFCNDTVVIPCFVTNMEAQNTTEVYVKWKF
KGRDIYTFDGALNKSTVPTDFSSAKIEVSQLLKGDASLKMDKSDAVSHTGNYTCEVTELT REGETIIELKYRVVSWFSPNENILIVIFPIFAILLFWGQFGIKTLKYRSGGMDEKTIALL VAGLVITVIVIVGAILFVPGEYSLKNATGLGLIVTSTGILILLHYYVFSTAIGLTSFVIA ILVIQVIAYILAVVGLSLCIAACIPMHGPLLISGLSILALAQLLGLVYMKFVASNQKTIQ PPRKAVEEPLNAFKESKGMMNDE Click to Show/Hide
|
|||||
| Function |
Adhesive protein that mediates cell-to-cell interactions. Acts as receptor for thrombospondin THBS1 and as modulator of integrin signaling through the activation of heterotrimeric G proteins. Involved in signal transduction, cardiovascular homeostasis, inflammation, apoptosis, angiogenesis, cellular self- renewal, and immunoregulation. Plays a role in modulating pulmonary endothelin EDN1 signaling. Modulates nitrous oxide (NO) signaling, in response to THBS1, hence playing a role as a pressor agent, supporting blood pressure. Plays an important role in memory formation and synaptic plasticity in the hippocampus. Receptor for SIRPA, binding to which prevents maturation of immature dendritic cells and inhibits cytokine production by mature dendritic cells. Interaction with SIRPG mediates cell-cell adhesion, enhances superantigen-dependent T-cell-mediated proliferation and costimulates T-cell activation. Positively modulates FAS-dependent apoptosis in T-cells, perhaps by enhancing FAS clustering. Plays a role in suppressing angiogenesis and may be involved in metabolic dysregulation during normal aging. In response to THBS1, negatively modulates wound healing. Inhibits stem cell self-renewal, in response to THBS1, probably by regulation of the stem cell transcription factors POU5F1/OCT4, SOX2, MYC/c-Myc and KLF4. May play a role in membrane transport and/or integrin dependent signal transduction. May prevent premature elimination of red blood cells.
Click to Show/Hide
|
|||||
| Uniprot Entry | ||||||
| HGNC ID | ||||||
| KEGG ID | ||||||
Each Antibody-drug Conjuate AND It's Component Related to This Antigen
Full List of The ADC Related to This Antigen
7DC2
| ADC Info | ADC Name | Payload | Target | Linker | Ref |
|---|---|---|---|---|---|
40187444 7DC2-DM1 |
Mertansine DM1 |
Undisclosed |
Succinimidyl-4- (N-maleimidomethyl)cyclohexane-1-carboxylate (SMCC) |
[1] |
7DC4
| ADC Info | ADC Name | Payload | Target | Linker | Ref |
|---|---|---|---|---|---|
40187444 7DC4-DM1 |
Mertansine DM1 |
Undisclosed |
Succinimidyl-4- (N-maleimidomethyl)cyclohexane-1-carboxylate (SMCC) |
[1] |
Anti-CD47 ALTA-002 mAb
| ADC Info | ADC Name | Payload | Target | Linker | Ref |
|---|---|---|---|---|---|
ALTA-002 |
Differentiated TLR-9 agonist (T-CpG) |
Undisclosed |
Undisclosed |
Anti-CD47 mAb (IgG2b/kappa)-
| ADC Info | ADC Name | Payload | Target | Linker | Ref |
|---|---|---|---|---|---|
Anti-CD47 mAb (IgG2b/kappa)-DM1 |
Mertansine DM1 |
Microtubule (MT) |
Succinimidyl-4-(N-maleimidomethyl)cyclohexane-1-carboxylate (SMCC) |
[2] |
Humanized anti-CD47 IgG1 mAb
| ADC Info | ADC Name | Payload | Target | Linker | Ref |
|---|---|---|---|---|---|
SGN-CD47M |
Monomethyl auristatin E |
Undisclosed |
Metalloproteinases cleavable linker |
MIAP410
| ADC Info | ADC Name | Payload | Target | Linker | Ref |
|---|---|---|---|---|---|
CD47-LLO |
Listeriolysin O |
Undisclosed |
Undisclosed |
[3] |
Undisclosed
| ADC Info | ADC Name | Payload | Target | Linker | Ref |
|---|---|---|---|---|---|
YB1-ADC-CD47 |
Undisclosed |
Undisclosed |
Undisclosed |
[4] |
undisclosed
| ADC Info | ADC Name | Payload | Target | Linker | Ref |
|---|---|---|---|---|---|
ATICC |
Trojan TLR7/8a |
Undisclosed |
Undisclosed |
[5] |
References
