General Information of This Antigen
Antigen ID
TAR0KQVKE
Antigen Name
C-type lectin domain family 7 member A (CLEC7A)
Gene Name
CLEC7A
Gene ID
64581
Synonym
Beta-glucan receptor;C-type lectin superfamily member 12;Dendritic cell-associated C-type lectin 1;CD_antigen=CD369
Sequence
MEYHPDLENLDEDGYTQLHFDSQSNTRIAVVSEKGSCAASPPWRLIAVILGILCLVILVI
AVVLGTMAIWRSNSGSNTLENGYFLSRNKENHSQPTQSSLEDSVTPTKAVKTTGVLSSPC
PPNWIIYEKSCYLFSMSLNSWDGSKRQCWQLGSNLLKIDSSNELGFIVKQVSSQPDNSFW
IGLSRPQTEVPWLWEDGSTFSSNLFQIRTTATQENPSPNCVWIHVSVIYDQLCSVPSYSI
CEKKFSM

    Click to Show/Hide
Function
Lectin that functions as pattern recognizing receptor (PRR) specific for beta-1,3-linked and beta-1,6-linked glucans, which constitute cell wall constituents from pathogenic bacteria and fungi. Necessary for the TLR2-mediated inflammatory response and activation of NF-kappa-B: upon beta-glucan binding, recruits SYK via its ITAM motif and promotes a signaling cascade that activates some CARD domain-BCL10-MALT1 (CBM) signalosomes, leading to the activation of NF-kappa-B and MAP kinase p38 (MAPK11, MAPK12, MAPK13 and/or MAPK14) pathways which stimulate expression of genes encoding pro-inflammatory cytokines and chemokines. Enhances cytokine production in macrophages and dendritic cells. Mediates production of reactive oxygen species in the cell. Mediates phagocytosis of C.albicans conidia. Binds T-cells in a way that does not involve their surface glycans and plays a role in T-cell activation. Stimulates T-cell proliferation. Induces phosphorylation of SCIMP after binding beta-glucans.

    Click to Show/Hide
Uniprot Entry
CLC7A_HUMAN
HGNC ID
HGNC:14558
KEGG ID
hsa:64581
Each Antibody-drug Conjuate AND It's Component Related to This Antigen
Full List of The ADC Related to This Antigen
Undisclosed
ADC Info ADC Name Payload Target Linker Ref
Alpha-human dectin-1-pam3 conjugate
NAMPT toxophore
Nicotinamide phosphoribosyltransferase (NAMPT)
Undisclosed
[1]
Tissue/Disease specific Abundances of This Antigen
Tissue specific Abundances of This Antigen
ICD Disease Classification 01
Click to Show/Hide the 1 Disease of This Class
Bacterial infection [ICD-11: 1A00-1C4Z]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Gingival
The Specific Disease Bacterial infection of gingival
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.571414182; Fold-change: -0.07837582; Z-score: -0.184173902
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 02
Click to Show/Hide the 22 Disease of This Class
Brain cancer [ICD-11: 2A00]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Brainstem
The Specific Disease Glioma
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.834216539; Fold-change: -0.142055621; Z-score: -0.189131001
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
The Studied Tissue White matter
The Specific Disease Glioma
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.512231252; Fold-change: 0.097230462; Z-score: 0.082035461
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
The Studied Tissue Brainstem
The Specific Disease Neuroectodermal tumor
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 2.27E-06; Fold-change: -1.355984371; Z-score: -3.426916232
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
The Studied Tissue Nervous
The Specific Disease Brain cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 6.58E-58; Fold-change: 0.455954798; Z-score: 1.17884162
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Chronic myeloid leukemia [ICD-11: 2A20]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Whole blood
The Specific Disease Polycythemia vera
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 6.68E-11; Fold-change: -0.536683617; Z-score: -1.554348633
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
The Studied Tissue Whole blood
The Specific Disease Myelofibrosis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.000126655; Fold-change: -0.757329398; Z-score: -2.209301443
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
MyeloDysplastic syndromes [ICD-11: 2A37]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Bone marrow
The Specific Disease Myelodysplastic syndromes
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.23825301; Fold-change: 0.069589964; Z-score: 0.135094576
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.356197838; Fold-change: 0.076417397; Z-score: 0.207175659
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Lymphoma [ICD-11: 2A90- 2A85]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Tonsil
The Specific Disease Lymphoma
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.744928864; Fold-change: -0.030773406; Z-score: -0.161810685
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Gastric cancer [ICD-11: 2B72]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Gastric
The Specific Disease Gastric cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.016726114; Fold-change: 0.99505892; Z-score: 4.189339573
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 3.39E-05; Fold-change: 0.293504418; Z-score: 0.925540272
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Colon cancer [ICD-11: 2B90]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Colon
The Specific Disease Colon cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.168555169; Fold-change: -0.08407654; Z-score: -0.223927904
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.025650665; Fold-change: 0.10882002; Z-score: 0.194406524
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Pancreatic cancer [ICD-11: 2C10]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Pancreas
The Specific Disease Pancreatic cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.000550849; Fold-change: 0.613795125; Z-score: 1.149861471
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.030801615; Fold-change: 0.543656739; Z-score: 0.665235905
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Liver cancer [ICD-11: 2C12]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Liver
The Specific Disease Liver cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.000267122; Fold-change: -0.357135698; Z-score: -0.735425225
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.434185662; Fold-change: -0.077998979; Z-score: -0.174663057
The Expression Level of Disease Section Compare with the Other Disease Section p-value: 0.035388109; Fold-change: -0.802013939; Z-score: -2.259595425
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Lung cancer [ICD-11: 2C25]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Lung
The Specific Disease Lung cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 9.05E-15; Fold-change: -0.439315477; Z-score: -0.830739133
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 5.54E-05; Fold-change: -0.399941688; Z-score: -0.576168105
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Melanoma [ICD-11: 2C30]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Skin
The Specific Disease Melanoma
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.005228008; Fold-change: 0.583893136; Z-score: 0.739215331
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Sarcoma [ICD-11: 2C35]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Muscle
The Specific Disease Sarcoma
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 1.39E-23; Fold-change: 0.128308946; Z-score: 0.600787748
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 1.53E-08; Fold-change: 0.400573684; Z-score: 6.000539264
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Breast cancer [ICD-11: 2C60]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Breast
The Specific Disease Breast cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 8.57E-112; Fold-change: 0.798175375; Z-score: 2.308288796
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 5.15E-05; Fold-change: 0.288334445; Z-score: 0.579883228
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Ovarian cancer [ICD-11: 2C73]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Ovarian
The Specific Disease Ovarian cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.001310503; Fold-change: 0.50722971; Z-score: 1.653155825
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 2.35E-05; Fold-change: 0.608282719; Z-score: 1.859749009
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Cervical cancer [ICD-11: 2C77]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Cervical
The Specific Disease Cervical cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 2.19E-07; Fold-change: 0.549200747; Z-score: 1.321944637
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Uterine cancer [ICD-11: 2C78]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Endometrium
The Specific Disease Uterine cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 2.11E-20; Fold-change: 0.269376732; Z-score: 0.724681023
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 1.06E-09; Fold-change: 0.604706783; Z-score: 4.992111285
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Prostate cancer [ICD-11: 2C82]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Prostate
The Specific Disease Prostate cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.01102792; Fold-change: 0.645538903; Z-score: 1.05188767
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Bladder cancer [ICD-11: 2C94]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Bladder
The Specific Disease Bladder cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.813524188; Fold-change: -0.021176343; Z-score: -0.055646469
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Retina cancer [ICD-11: 2D02]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Uvea
The Specific Disease Retinoblastoma tumor
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.000281725; Fold-change: 1.292277745; Z-score: 6.797187101
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Thyroid cancer [ICD-11: 2D10]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Thyroid
The Specific Disease Thyroid cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 2.88E-21; Fold-change: 0.868640822; Z-score: 1.643427521
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 3.89E-11; Fold-change: 0.69680669; Z-score: 1.657344538
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Adrenal cancer [ICD-11: 2D11]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Adrenal cortex
The Specific Disease Adrenocortical carcinoma
The Expression Level of Disease Section Compare with the Other Disease Section p-value: 0.01632778; Fold-change: -0.326399961; Z-score: -0.901864259
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Head and neck cancer [ICD-11: 2D42]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Head and neck
The Specific Disease Head and neck cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 3.12E-34; Fold-change: 1.384261437; Z-score: 2.187157828
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Pituitary cancer [ICD-11: 2F37]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Pituitary
The Specific Disease Pituitary gonadotrope tumor
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.751638627; Fold-change: -0.063870887; Z-score: -0.304514409
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
The Studied Tissue Pituitary
The Specific Disease Pituitary cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.46447849; Fold-change: 0.038150281; Z-score: 0.200664192
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 03
Click to Show/Hide the 1 Disease of This Class
Thrombocytopenia [ICD-11: 3B64]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Whole blood
The Specific Disease Thrombocytopenia
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.549453404; Fold-change: -0.560507357; Z-score: -0.681622171
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 04
Click to Show/Hide the 2 Disease of This Class
Lupus erythematosus [ICD-11: 4A40]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Whole blood
The Specific Disease Lupus erythematosus
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 2.09E-05; Fold-change: 0.964979455; Z-score: 0.626174048
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Autoimmune disease [ICD-11: 4A4Z]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Peripheral monocyte
The Specific Disease Autoimmune uveitis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.102244781; Fold-change: -0.712357614; Z-score: -1.052090496
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 05
Click to Show/Hide the 1 Disease of This Class
Hyperlipoproteinaemia [ICD-11: 5C80]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Whole blood
The Specific Disease Familial hypercholesterolemia
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 1.76E-05; Fold-change: 0.853278366; Z-score: 1.028039411
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 06
Click to Show/Hide the 1 Disease of This Class
Schizophrenia [ICD-11: 6A20]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Superior temporal cortex
The Specific Disease Schizophrenia
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.052801223; Fold-change: 0.097811533; Z-score: 0.689088034
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 08
Click to Show/Hide the 3 Disease of This Class
Multiple sclerosis [ICD-11: 8A40]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Spinal cord
The Specific Disease Multiple sclerosis
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.224360402; Fold-change: 0.347663428; Z-score: 0.958483711
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
The Studied Tissue Plasmacytoid dendritic cells
The Specific Disease Multiple sclerosis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.021209839; Fold-change: 0.772007001; Z-score: 0.964508231
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Epilepsy [ICD-11: 8A60]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Peritumoral cortex
The Specific Disease Epilepsy
The Expression Level of Disease Section Compare with the Other Disease Section p-value: 0.307409551; Fold-change: -0.620723115; Z-score: -0.780607146
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Cerebral ischaemic stroke [ICD-11: 8B11]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Whole blood
The Specific Disease Cardioembolic Stroke
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 1.04E-06; Fold-change: 0.613103594; Z-score: 1.503887055
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
The Studied Tissue Peripheral blood
The Specific Disease Ischemic stroke
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.673597962; Fold-change: 0.070164901; Z-score: 0.152567706
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 1
Click to Show/Hide the 6 Disease of This Class
HIV [ICD-11: 1C60-1C62]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue White matter
The Specific Disease HIV
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.881261444; Fold-change: 0.063601472; Z-score: 0.194113411
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Influenza [ICD-11: 1E30]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Whole blood
The Specific Disease Influenza
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.450892357; Fold-change: 0.607200091; Z-score: 0.585644857
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Chronic hepatitis C [ICD-11: 1E51.1]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Whole blood
The Specific Disease Chronic hepatitis C
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.636658806; Fold-change: -0.286475257; Z-score: -0.137343059
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Sepsis [ICD-11: 1G40-1G41]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Whole blood
The Specific Disease Sepsis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 2.16E-14; Fold-change: 1.122000298; Z-score: 1.521242927
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Septic shock [ICD-11: 1G41]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Whole blood
The Specific Disease Septic shock
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.265150427; Fold-change: 0.162155878; Z-score: 0.238171172
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Pediatric respiratory syncytial virus infection [ICD-11: CA40.11]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Peripheral blood
The Specific Disease Pediatric respiratory syncytial virus infection
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.00312413; Fold-change: 0.828802869; Z-score: 0.907711943
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 11
Click to Show/Hide the 6 Disease of This Class
Essential hypertension [ICD-11: BA00]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Peripheral blood
The Specific Disease Essential hypertension
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.223250611; Fold-change: -0.097104947; Z-score: -0.205077823
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Myocardial infarction [ICD-11: BA41]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Peripheral blood
The Specific Disease Myocardial infarction
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 1.43E-07; Fold-change: 1.308263916; Z-score: 0.938091038
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Coronary artery disease [ICD-11: BA8Z]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Peripheral blood
The Specific Disease Coronary artery disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.916132525; Fold-change: 0.042261033; Z-score: 0.052642851
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Aortic stenosis [ICD-11: BB70]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Calcified aortic valve
The Specific Disease Aortic stenosis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.55994943; Fold-change: -0.010450506; Z-score: -0.020496271
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Arteriosclerosis [ICD-11: BD40]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Peripheral blood
The Specific Disease Arteriosclerosis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.08440901; Fold-change: -0.467515689; Z-score: -0.815774447
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Aneurysm [ICD-11: BD50]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Intracranial artery
The Specific Disease Aneurysm
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.00017411; Fold-change: 1.369251834; Z-score: 2.213669251
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 12
Click to Show/Hide the 8 Disease of This Class
Immunodeficiency [ICD-11: 4A00-4A20]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Peripheral blood
The Specific Disease Immunodeficiency
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.273767557; Fold-change: 0.021752761; Z-score: 0.353912675
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Apnea [ICD-11: 7A40]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Hyperplastic tonsil
The Specific Disease Apnea
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.003730488; Fold-change: -0.264911625; Z-score: -1.875760055
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Olive pollen allergy [ICD-11: CA08.00]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Peripheral blood
The Specific Disease Olive pollen allergy
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.436614751; Fold-change: 0.630426519; Z-score: 0.643084463
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Chronic rhinosinusitis [ICD-11: CA0A]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Sinus mucosa
The Specific Disease Chronic rhinosinusitis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.005440609; Fold-change: 0.327196211; Z-score: 2.486482969
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Chronic obstructive pulmonary disease [ICD-11: CA22]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Lung
The Specific Disease Chronic obstructive pulmonary disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.65709779; Fold-change: -0.029519574; Z-score: -0.033119456
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
The Studied Tissue Small airway epithelium
The Specific Disease Chronic obstructive pulmonary disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.015417365; Fold-change: 0.33433086; Z-score: 0.744220843
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Asthma [ICD-11: CA23]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Nasal and bronchial airway
The Specific Disease Asthma
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 2.64E-06; Fold-change: 0.920147828; Z-score: 0.957757983
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Human rhinovirus infection [ICD-11: CA42]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Nasal Epithelium
The Specific Disease Human rhinovirus infection
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.131067163; Fold-change: 0.134649793; Z-score: 0.287323473
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Idiopathic pulmonary fibrosis [ICD-11: CB03.4]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Lung
The Specific Disease Idiopathic pulmonary fibrosis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.007902181; Fold-change: -0.844985377; Z-score: -1.770680221
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 13
Click to Show/Hide the 5 Disease of This Class
Periodontal disease [ICD-11: DA0C]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Gingival
The Specific Disease Periodontal disease
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.333579784; Fold-change: -0.041527764; Z-score: -0.090744659
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Eosinophilic gastritis [ICD-11: DA42.2]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Gastric antrum
The Specific Disease Eosinophilic gastritis
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.196493045; Fold-change: 0.125840419; Z-score: 1.258199127
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Liver failure [ICD-11: DB99.7-DB99.8]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Liver
The Specific Disease Liver failure
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.000152603; Fold-change: 1.064646996; Z-score: 8.555227335
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Ulcerative colitis [ICD-11: DD71]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Colon mucosal
The Specific Disease Ulcerative colitis
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.000119845; Fold-change: 0.404326972; Z-score: 1.49982327
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Irritable bowel syndrome [ICD-11: DD91.0]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Rectal colon
The Specific Disease Irritable bowel syndrome
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.030440371; Fold-change: -0.119216118; Z-score: -0.285526775
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 14
Click to Show/Hide the 5 Disease of This Class
Atopic dermatitis [ICD-11: EA80]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Skin
The Specific Disease Atopic dermatitis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.021636125; Fold-change: 0.219632626; Z-score: 0.657758588
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Psoriasis [ICD-11: EA90]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Skin
The Specific Disease Psoriasis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 7.62E-44; Fold-change: 1.401849829; Z-score: 3.054128081
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 7.48E-18; Fold-change: 0.950000708; Z-score: 1.861920599
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Vitiligo [ICD-11: ED63.0]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Skin
The Specific Disease Vitiligo
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.36211343; Fold-change: 0.098857713; Z-score: 0.358020509
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Alopecia [ICD-11: ED70]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Skin from scalp
The Specific Disease Alopecia
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.004098268; Fold-change: 0.554813814; Z-score: 0.884446302
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Sensitive skin [ICD-11: EK0Z]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Skin
The Specific Disease Sensitive skin
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.467811133; Fold-change: 0.169792505; Z-score: 0.895378193
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 15
Click to Show/Hide the 6 Disease of This Class
Osteoarthritis [ICD-11: FA00-FA0Z]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Synovial
The Specific Disease Osteoarthritis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.865582673; Fold-change: -0.032670491; Z-score: -0.07804819
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Arthropathy [ICD-11: FA00-FA5Z]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Peripheral blood
The Specific Disease Arthropathy
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.467845854; Fold-change: 0.405973916; Z-score: 0.92455245
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Arthritis [ICD-11: FA20]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Peripheral blood
The Specific Disease Arthritis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 8.22E-05; Fold-change: 0.307328813; Z-score: 0.680709781
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Rheumatoid arthritis [ICD-11: FA20]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Synovial
The Specific Disease Rheumatoid arthritis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.072942782; Fold-change: 0.456922258; Z-score: 1.317072451
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Ankylosing spondylitis [ICD-11: FA92.0Z]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Pheripheral blood
The Specific Disease Ankylosing spondylitis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.088545794; Fold-change: 0.159810923; Z-score: 0.424029528
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Osteoporosis [ICD-11: FB83]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Bone marrow
The Specific Disease Osteoporosis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.015931497; Fold-change: 0.323779896; Z-score: 2.812384718
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 16
Click to Show/Hide the 2 Disease of This Class
Endometriosis [ICD-11: GA10]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Endometrium
The Specific Disease Endometriosis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.034124738; Fold-change: 0.062077187; Z-score: 0.328431653
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Interstitial cystitis [ICD-11: GC00.3]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Bladder
The Specific Disease Interstitial cystitis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 7.37E-05; Fold-change: 1.475620138; Z-score: 4.522000415
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 19
Click to Show/Hide the 1 Disease of This Class
Preterm birth [ICD-11: KA21.4Z]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Myometrium
The Specific Disease Preterm birth
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.376782888; Fold-change: -0.260354351; Z-score: -0.523983336
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 2
Click to Show/Hide the 8 Disease of This Class
Acute myelocytic leukemia [ICD-11: 2A60]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Bone marrow
The Specific Disease Acute myelocytic leukemia
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 7.35E-14; Fold-change: -0.581453591; Z-score: -0.886723572
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Myeloma [ICD-11: 2A83]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Bone marrow
The Specific Disease Myeloma
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.078860248; Fold-change: -0.490108537; Z-score: -1.112015302
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
The Studied Tissue Peripheral blood
The Specific Disease Myeloma
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.288954145; Fold-change: 0.157001269; Z-score: 0.395478066
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Oral cancer [ICD-11: 2B6E]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Oral
The Specific Disease Oral cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.00010749; Fold-change: 0.716785363; Z-score: 1.154763576
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.295371736; Fold-change: -0.547536815; Z-score: -0.571485919
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Esophagal cancer [ICD-11: 2B70]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Esophagus
The Specific Disease Esophagal cancer
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.299297092; Fold-change: -0.90551289; Z-score: -0.843250738
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Rectal cancer [ICD-11: 2B92]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Rectal colon
The Specific Disease Rectal cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.252263887; Fold-change: 0.094543624; Z-score: 0.326461697
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.936939782; Fold-change: -0.010719174; Z-score: -0.040607268
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Skin cancer [ICD-11: 2C30-2C3Z]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Skin
The Specific Disease Skin cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 3.02E-13; Fold-change: 0.396032505; Z-score: 0.845726195
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 5.01E-06; Fold-change: 0.167254253; Z-score: 0.29073735
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Renal cancer [ICD-11: 2C90-2C91]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Kidney
The Specific Disease Renal cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 6.86E-10; Fold-change: 0.970217627; Z-score: 4.415328102
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 1.32E-24; Fold-change: 1.006712945; Z-score: 2.24938289
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Ureter cancer [ICD-11: 2C92]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Urothelium
The Specific Disease Ureter cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.131141077; Fold-change: 0.091584227; Z-score: 0.71961016
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 20
Click to Show/Hide the 2 Disease of This Class
Simpson golabi behmel syndrome [ICD-11: LD2C]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Adipose
The Specific Disease Simpson golabi behmel syndrome
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.568991179; Fold-change: 0.04253624; Z-score: 0.838939997
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Tuberous sclerosis complex [ICD-11: LD2D.2]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Perituberal
The Specific Disease Tuberous sclerosis complex
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.003833737; Fold-change: 0.738933585; Z-score: 6.890731679
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 3
Click to Show/Hide the 3 Disease of This Class
Anemia [ICD-11: 3A00-3A9Z]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Bone marrow
The Specific Disease Anemia
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.833015322; Fold-change: -0.014073435; Z-score: -0.026099312
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Sickle cell disease [ICD-11: 3A51.0-3A51.3]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Peripheral blood
The Specific Disease Sickle cell disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.803166666; Fold-change: 0.051907375; Z-score: 0.500220753
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Thrombocythemia [ICD-11: 3B63]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Whole blood
The Specific Disease Thrombocythemia
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 1.46E-08; Fold-change: -0.497274009; Z-score: -1.449185854
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 4
Click to Show/Hide the 4 Disease of This Class
Scleroderma [ICD-11: 4A42.Z]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Whole blood
The Specific Disease Scleroderma
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 1.85E-09; Fold-change: 0.847984531; Z-score: 4.146871893
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Sjogren syndrome [ICD-11: 4A43]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Salivary gland
The Specific Disease Sjogren syndrome
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.361601888; Fold-change: -0.021160515; Z-score: -0.457126203
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.072055399; Fold-change: 0.165491033; Z-score: 0.753060765
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Behcet disease [ICD-11: 4A62]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Peripheral blood
The Specific Disease Behcet disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.63886162; Fold-change: -0.071289857; Z-score: -0.151604495
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Autosomal dominant monocytopenia [ICD-11: 4B04]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Whole blood
The Specific Disease Autosomal dominant monocytopenia
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.061283411; Fold-change: -0.563895607; Z-score: -1.346338671
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 5
Click to Show/Hide the 5 Disease of This Class
Type 2 diabetes [ICD-11: 5A11]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Liver
The Specific Disease Type 2 diabetes
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.161300342; Fold-change: 0.134054274; Z-score: 1.745370765
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Polycystic ovary syndrome [ICD-11: 5A80.1]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Vastus lateralis muscle
The Specific Disease Polycystic ovary syndrome
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.243575284; Fold-change: 0.089306221; Z-score: 0.470521765
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Obesity [ICD-11: 5B81]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Subcutaneous Adipose
The Specific Disease Obesity
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.10318271; Fold-change: 0.26531625; Z-score: 0.492056925
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Pompe disease [ICD-11: 5C51.3]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Biceps muscle
The Specific Disease Pompe disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.082390957; Fold-change: 0.682615241; Z-score: 1.68967012
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Batten disease [ICD-11: 5C56.1]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Whole blood
The Specific Disease Batten disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.908942409; Fold-change: 0.034391467; Z-score: 0.076901237
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 6
Click to Show/Hide the 2 Disease of This Class
Autism [ICD-11: 6A02]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Whole blood
The Specific Disease Autism
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.580248715; Fold-change: -0.076757016; Z-score: -0.081824848
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Anxiety disorder [ICD-11: 6B00-6B0Z]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Whole blood
The Specific Disease Anxiety disorder
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.060588483; Fold-change: 0.127039613; Z-score: 0.403594805
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 8
Click to Show/Hide the 7 Disease of This Class
Parkinson disease [ICD-11: 8A00]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Substantia nigra
The Specific Disease Parkinson disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.450190223; Fold-change: 0.037187842; Z-score: 0.107693695
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Huntington disease [ICD-11: 8A01]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Whole blood
The Specific Disease Huntington disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.077408192; Fold-change: 0.743121084; Z-score: 1.065953034
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Alzheimer disease [ICD-11: 8A20]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Entorhinal cortex
The Specific Disease Alzheimer disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 7.11E-06; Fold-change: 0.170723516; Z-score: 0.608321119
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Seizure [ICD-11: 8A60-8A6Z]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Whole blood
The Specific Disease Seizure
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.720376775; Fold-change: -0.042491707; Z-score: -0.038433323
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Lateral sclerosis [ICD-11: 8B60.4]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Skin
The Specific Disease Lateral sclerosis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.783985466; Fold-change: -0.006485395; Z-score: -0.044784122
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
The Studied Tissue Cervical spinal cord
The Specific Disease Lateral sclerosis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.476413916; Fold-change: -0.075561681; Z-score: -0.549189022
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Muscular atrophy [ICD-11: 8C70]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Muscle
The Specific Disease Muscular atrophy
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 1.34E-06; Fold-change: 0.45354888; Z-score: 2.369343613
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Myopathy [ICD-11: 8C70.6]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Muscle
The Specific Disease Myopathy
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 5.45E-06; Fold-change: 0.443459345; Z-score: 4.003922892
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
References
Ref 1 Introduction to basic information on ADC drug alpha-human Dectin-1-Pam3 conjugate(Dynavax Technologies).