Antigen Information
General Information of This Antigen
| Antigen ID | TAR0KOXJT |
|||||
|---|---|---|---|---|---|---|
| Antigen Name | T cell receptor alpha chain constant (TRAC) |
|||||
| Gene Name | TRAC |
|||||
| Synonym | TCRA |
|||||
| Sequence |
IQNPDPAVYQLRDSKSSDKSVCLFTDFDSQTNVSQSKDSDVYITDKTVLDMRSMDFKSNS
AVAWSNKSDFACANAFNNSIIPEDTFFPSPESSCDVKLVEKSFETDTNLNFQNLSVIGFR ILLLKVAGFNLLMTLRLWSS Click to Show/Hide
|
|||||
| Function |
Constant region of T cell receptor (TR) alpha chain. Alpha-beta T cell receptors are antigen specific receptors which are essential to the immune response and are present on the cell surface of T lymphocytes. Recognize peptide-major histocompatibility (MH) (pMH) complexes that are displayed by antigen presenting cells (APC), a prerequisite for efficient T cell adaptive immunity against pathogens. Binding of alpha-beta TR to pMH complex initiates TR-CD3 clustering on the cell surface and intracellular activation of LCK that phosphorylates the ITAM motifs of CD3G, CD3D, CD3E and CD247 enabling the recruitment of ZAP70. In turn, ZAP70 phosphorylates LAT, which recruits numerous signaling molecules to form the LAT signalosome. The LAT signalosome propagates signal branching to three major signaling pathways, the calcium, the mitogen- activated protein kinase (MAPK) kinase and the nuclear factor NF-kappa- B (NF-kB) pathways, leading to the mobilization of transcription factors that are critical for gene expression and essential for T cell growth and differentiation. The T cell repertoire is generated in the thymus, by V-(D)-J rearrangement. This repertoire is then shaped by intrathymic selection events to generate a peripheral T cell pool of self-MH restricted, non-autoaggressive T cells. Post- thymic interaction of alpha-beta TR with the pMH complexes shapes TR structural and functional avidity.
Click to Show/Hide
|
|||||
| Uniprot Entry | ||||||
| HGNC ID | ||||||
Each Antibody-drug Conjuate AND It's Component Related to This Antigen
Full List of The ADC Related to This Antigen
Anti-TRAC mAb H66
| ADC Info | ADC Name | Payload | Target | Linker | Ref |
|---|---|---|---|---|---|
H66-Mc-Val-Cit-PABC-MMAE |
Monomethyl auristatin E |
Microtubule (MT) |
Mc-Val-Cit-PABC |
[1] |
Anti-TRAC mAb H66 N297Q/S298N/Y300S
| ADC Info | ADC Name | Payload | Target | Linker | Ref |
|---|---|---|---|---|---|
H66 N297Q/S298N/Y300S-Mc-Val-Cit-PABC-MMAE |
Monomethyl auristatin E |
Microtubule (MT) |
Mc-Val-Cit-PABC |
[1] |
Anti-TRAC mAb H66 S298N/T299A/Y300S
| ADC Info | ADC Name | Payload | Target | Linker | Ref |
|---|---|---|---|---|---|
H66 S298N/T299A/Y300S-Mc-Val-Cit-PABC-MMAE |
Monomethyl auristatin E |
Microtubule (MT) |
Mc-Val-Cit-PABC |
[1] |
Anti-TRAC mAb H66 S298N/Y300S
| ADC Info | ADC Name | Payload | Target | Linker | Ref |
|---|---|---|---|---|---|
H66 S298N/Y300S-Mc-Val-Cit-PABC-MMAE |
Monomethyl auristatin E |
Microtubule (MT) |
Mc-Val-Cit-PABC |
[1] |
If you find any error in data or bug in web service, please kindly report it to Dr. Shen et al.
