Antigen Information
General Information of This Antigen
Antigen ID | TAR0JNOKW |
|||||
---|---|---|---|---|---|---|
Antigen Name | CD44 antigen (CD44) |
|||||
Gene Name | CD44 |
|||||
Gene ID | ||||||
Synonym | LHR; MDU2; MDU3; MIC4; CDw44;Epican;Extracellular matrix receptor III;GP90 lymphocyte homing/adhesion receptor;HUTCH-I;Heparan sulfate proteoglycan;Hermes antigen;Hyaluronate receptor;Phagocytic glycoprotein 1;Phagocytic glycoprotein I;CD_antigen=CD44 |
|||||
Sequence |
MDKFWWHAAWGLCLVPLSLAQIDLNITCRFAGVFHVEKNGRYSISRTEAADLCKAFNSTL
PTMAQMEKALSIGFETCRYGFIEGHVVIPRIHPNSICAANNTGVYILTSNTSQYDTYCFN ASAPPEEDCTSVTDLPNAFDGPITITIVNRDGTRYVQKGEYRTNPEDIYPSNPTDDDVSS GSSSERSSTSGGYIFYTFSTVHPIPDEDSPWITDSTDRIPATTLMSTSATATETATKRQE TWDWFSWLFLPSESKNHLHTTTQMAGTSSNTISAGWEPNEENEDERDRHLSFSGSGIDDD EDFISSTISTTPRAFDHTKQNQDWTQWNPSHSNPEVLLQTTTRMTDVDRNGTTAYEGNWN PEAHPPLIHHEHHEEEETPHSTSTIQATPSSTTEETATQKEQWFGNRWHEGYRQTPKEDS HSTTGTAAASAHTSHPMQGRTTPSPEDSSWTDFFNPISHPMGRGHQAGRRMDMDSSHSIT LQPTANPNTGLVEDLDRTGPLSMTTQQSNSQSFSTSHEGLEEDKDHPTTSTLTSSNRNDV TGGRRDPNHSEGSTTLLEGYTSHYPHTKESRTFIPVTSAKTGSFGVTAVTVGDSNSNVNR SLSGDQDTFHPSGGSHTTHGSESDGHSHGSQEGGANTTSGPIRTPQIPEWLIILASLLAL ALILAVCIAVNSRRRCGQKKKLVINSGNGAVEDRKPSGLNGEASKSQEMVHLVNKESSET PDQFMTADETRNLQNVDMKIGV Click to Show/Hide
|
|||||
Function |
Cell-surface receptor that plays a role in cell-cell interactions, cell adhesion and migration, helping them to sense and respond to changes in the tissue microenvironment. Participates thereby in a wide variety of cellular functions including the activation, recirculation and homing of T-lymphocytes, hematopoiesis, inflammation and response to bacterial infection. Engages, through its ectodomain, extracellular matrix components such as hyaluronan/HA, collagen, growth factors, cytokines or proteases and serves as a platform for signal transduction by assembling, via its cytoplasmic domain, protein complexes containing receptor kinases and membrane proteases. Such effectors include PKN2, the RhoGTPases RAC1 and RHOA, Rho-kinases and phospholipase C that coordinate signaling pathways promoting calcium mobilization and actin-mediated cytoskeleton reorganization essential for cell migration and adhesion.
Click to Show/Hide
|
|||||
Uniprot Entry | ||||||
HGNC ID | ||||||
KEGG ID |
Each Antibody-drug Conjuate AND It's Component Related to This Antigen
Full List of The ADC Related to This Antigen
Bivatuzumab
ADC Info | ADC Name | Payload | Target | Linker | Ref |
---|---|---|---|---|---|
Bivatuzumab-ADC-24-1 |
Bivatuzumab-ADC-24-1 payload |
Undisclosed |
Bivatuzumab-ADC-24-1 linker |
[1] | |
Bivatuzumab-ADC-24-2 |
Bivatuzumab-ADC-24-2 payload |
Undisclosed |
Bivatuzumab-ADC-24-2 linker |
[1] | |
Bivatuzumab-ADC-24-3 |
Bivatuzumab-ADC-24-3 payload |
Undisclosed |
Bivatuzumab-ADC-24-3 linker |
[1] | |
Bivatuzumab-ADC-24-4 |
Bivatuzumab-ADC-24-4 payload |
Undisclosed |
Bivatuzumab-ADC-24-4 linker |
[1] | |
Bivatuzumab-ADC-24-5 |
Bivatuzumab-ADC-24-5 payload |
Undisclosed |
Bivatuzumab-ADC-24-5 linker |
[1] | |
Bivatuzumab-ADC-24-6 |
Bivatuzumab-ADC-24-6 payload |
Undisclosed |
Bivatuzumab-ADC-24-6 linker |
[1] | |
Bivatuzumab-ADC-24-7 |
Bivatuzumab-ADC-24-7 payload |
Undisclosed |
Bivatuzumab-ADC-24-7 linker |
[1] | |
Bivatuzumab-ADC-24-8 |
Bivatuzumab-ADC-24-8 payload |
Undisclosed |
Bivatuzumab-ADC-24-8 linker |
[1] | |
Bivatuzumab-ADC-24-9 |
Bivatuzumab-ADC-24-9 payload |
Undisclosed |
Bivatuzumab-ADC-24-9 linker |
[1] | |
Bivatuzumab-ADC-24-10 |
Bivatuzumab-ADC-24-10 payload |
Undisclosed |
Bivatuzumab-ADC-24-10 linker |
[1] | |
Bivatuzumab-ADC-24-11 |
Bivatuzumab-ADC-24-11 payload |
Undisclosed |
Bivatuzumab-ADC-24-11 linker |
[1] | |
Bivatuzumab-ADC-24-12 |
Bivatuzumab-ADC-24-12 payload |
Undisclosed |
Bivatuzumab-ADC-24-12 linker |
[1] | |
Bivatuzumab-ADC-24-13 |
Bivatuzumab-ADC-24-13 payload |
Undisclosed |
Bivatuzumab-ADC-24-13 linker |
[1] | |
Bivatuzumab mertansine |
Mertansine DM1 |
Microtubule (MT) |
N-succinimidyl 4-(2-pyridyldithio) pentanoate (SPP) |
[2] |
Undisclosed
ADC Info | ADC Name | Payload | Target | Linker | Ref |
---|---|---|---|---|---|
AMT-029 |
Undisclosed |
Undisclosed |
Undisclosed |
[3] |
Tissue/Disease specific Abundances of This Antigen
Tissue specific Abundances of This Antigen
ICD Disease Classification 01
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Gingival | |
The Specific Disease | Bacterial infection of gingival | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.566103246; Fold-change: -0.070286651; Z-score: -0.205597683 | |
Disease-specific Antigen Abundances |
![]() |
Click to View the Clearer Original Diagram |
ICD Disease Classification 02
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Brainstem | |
The Specific Disease | Glioma | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.294786817; Fold-change: 0.812826966; Z-score: 1.282049247 | |
Disease-specific Antigen Abundances |
![]() |
Click to View the Clearer Original Diagram |
The Studied Tissue | White matter | |
The Specific Disease | Glioma | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.000968662; Fold-change: 1.257702672; Z-score: 1.490086006 | |
Disease-specific Antigen Abundances |
![]() |
Click to View the Clearer Original Diagram |
The Studied Tissue | Brainstem | |
The Specific Disease | Neuroectodermal tumor | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 6.16E-07; Fold-change: -2.121829466; Z-score: -3.95392279 | |
Disease-specific Antigen Abundances |
![]() |
Click to View the Clearer Original Diagram |
The Studied Tissue | Nervous | |
The Specific Disease | Brain cancer | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 4.94E-120; Fold-change: 1.596343984; Z-score: 2.111907904 | |
Disease-specific Antigen Abundances |
![]() |
Click to View the Clearer Original Diagram |
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Whole blood | |
The Specific Disease | Polycythemia vera | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.000531001; Fold-change: -0.338793006; Z-score: -1.797032746 | |
Disease-specific Antigen Abundances |
![]() |
Click to View the Clearer Original Diagram |
The Studied Tissue | Whole blood | |
The Specific Disease | Myelofibrosis | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 1.50E-07; Fold-change: -0.477840808; Z-score: -2.87059491 | |
Disease-specific Antigen Abundances |
![]() |
Click to View the Clearer Original Diagram |
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Bone marrow | |
The Specific Disease | Myelodysplastic syndromes | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.337668856; Fold-change: 0.063208242; Z-score: 0.110759302 | |
The Expression Level of Disease Section Compare with the Adjacent Tissue | p-value: 0.09750215; Fold-change: -1.493275481; Z-score: -1.19092246 | |
Disease-specific Antigen Abundances |
![]() |
Click to View the Clearer Original Diagram |
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Tonsil | |
The Specific Disease | Lymphoma | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.530268373; Fold-change: -0.214278808; Z-score: -0.653796583 | |
Disease-specific Antigen Abundances |
![]() |
Click to View the Clearer Original Diagram |
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Gastric | |
The Specific Disease | Gastric cancer | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.26164334; Fold-change: 0.800500547; Z-score: 0.817802969 | |
The Expression Level of Disease Section Compare with the Adjacent Tissue | p-value: 0.009879098; Fold-change: 0.304143073; Z-score: 0.417499758 | |
Disease-specific Antigen Abundances |
![]() |
Click to View the Clearer Original Diagram |
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Colon | |
The Specific Disease | Colon cancer | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 3.43E-59; Fold-change: 1.073057145; Z-score: 1.982635085 | |
The Expression Level of Disease Section Compare with the Adjacent Tissue | p-value: 9.59E-43; Fold-change: 1.547268496; Z-score: 1.812627847 | |
Disease-specific Antigen Abundances |
![]() |
Click to View the Clearer Original Diagram |
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Pancreas | |
The Specific Disease | Pancreatic cancer | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.949409851; Fold-change: 0.472341718; Z-score: 0.350445394 | |
The Expression Level of Disease Section Compare with the Adjacent Tissue | p-value: 0.608213949; Fold-change: 0.269421224; Z-score: 0.409767712 | |
Disease-specific Antigen Abundances |
![]() |
Click to View the Clearer Original Diagram |
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Liver | |
The Specific Disease | Liver cancer | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 1.17E-06; Fold-change: 0.216786263; Z-score: 0.511924529 | |
The Expression Level of Disease Section Compare with the Adjacent Tissue | p-value: 0.001391047; Fold-change: -0.036479246; Z-score: -0.068688104 | |
The Expression Level of Disease Section Compare with the Other Disease Section | p-value: 0.389117094; Fold-change: -0.10132663; Z-score: -0.270641017 | |
Disease-specific Antigen Abundances |
![]() |
Click to View the Clearer Original Diagram |
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Lung | |
The Specific Disease | Lung cancer | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 7.93E-24; Fold-change: -0.435078034; Z-score: -0.83605447 | |
The Expression Level of Disease Section Compare with the Adjacent Tissue | p-value: 1.93E-08; Fold-change: -0.378825764; Z-score: -0.50982907 | |
Disease-specific Antigen Abundances |
![]() |
Click to View the Clearer Original Diagram |
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Skin | |
The Specific Disease | Melanoma | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.311398003; Fold-change: 0.295083025; Z-score: 0.248651266 | |
Disease-specific Antigen Abundances |
![]() |
Click to View the Clearer Original Diagram |
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Muscle | |
The Specific Disease | Sarcoma | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 1.79E-116; Fold-change: 2.460109164; Z-score: 4.033011211 | |
The Expression Level of Disease Section Compare with the Adjacent Tissue | p-value: 5.65E-15; Fold-change: 2.699574813; Z-score: 23.46697748 | |
Disease-specific Antigen Abundances |
![]() |
Click to View the Clearer Original Diagram |
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Breast | |
The Specific Disease | Breast cancer | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 1.43E-17; Fold-change: 0.512465966; Z-score: 0.708714937 | |
The Expression Level of Disease Section Compare with the Adjacent Tissue | p-value: 0.330946387; Fold-change: -0.059984204; Z-score: -0.062032832 | |
Disease-specific Antigen Abundances |
![]() |
Click to View the Clearer Original Diagram |
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Ovarian | |
The Specific Disease | Ovarian cancer | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.016484003; Fold-change: 1.037337013; Z-score: 1.215547345 | |
The Expression Level of Disease Section Compare with the Adjacent Tissue | p-value: 0.043061637; Fold-change: 0.023316823; Z-score: 0.011459084 | |
Disease-specific Antigen Abundances |
![]() |
Click to View the Clearer Original Diagram |
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Cervical | |
The Specific Disease | Cervical cancer | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.265296118; Fold-change: 0.016997207; Z-score: 0.042144735 | |
Disease-specific Antigen Abundances |
![]() |
Click to View the Clearer Original Diagram |
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Endometrium | |
The Specific Disease | Uterine cancer | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 1.54E-05; Fold-change: -0.281029888; Z-score: -0.315485213 | |
The Expression Level of Disease Section Compare with the Adjacent Tissue | p-value: 0.000169751; Fold-change: -3.116910993; Z-score: -4.927780296 | |
Disease-specific Antigen Abundances |
![]() |
Click to View the Clearer Original Diagram |
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Prostate | |
The Specific Disease | Prostate cancer | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.137855809; Fold-change: -0.141422719; Z-score: -0.206644371 | |
Disease-specific Antigen Abundances |
![]() |
Click to View the Clearer Original Diagram |
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Bladder | |
The Specific Disease | Bladder cancer | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 3.32E-05; Fold-change: -0.686937018; Z-score: -3.487417017 | |
Disease-specific Antigen Abundances |
![]() |
Click to View the Clearer Original Diagram |
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Uvea | |
The Specific Disease | Retinoblastoma tumor | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 6.52E-14; Fold-change: 5.332835362; Z-score: 6.403231999 | |
Disease-specific Antigen Abundances |
![]() |
Click to View the Clearer Original Diagram |
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Thyroid | |
The Specific Disease | Thyroid cancer | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 1.40E-38; Fold-change: 1.160809574; Z-score: 2.030038055 | |
The Expression Level of Disease Section Compare with the Adjacent Tissue | p-value: 6.98E-16; Fold-change: 1.206030627; Z-score: 1.977347487 | |
Disease-specific Antigen Abundances |
![]() |
Click to View the Clearer Original Diagram |
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Adrenal cortex | |
The Specific Disease | Adrenocortical carcinoma | |
The Expression Level of Disease Section Compare with the Other Disease Section | p-value: 0.001068827; Fold-change: -0.445161091; Z-score: -1.832630392 | |
Disease-specific Antigen Abundances |
![]() |
Click to View the Clearer Original Diagram |
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Head and neck | |
The Specific Disease | Head and neck cancer | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 4.11E-33; Fold-change: 1.108414773; Z-score: 1.829080388 | |
Disease-specific Antigen Abundances |
![]() |
Click to View the Clearer Original Diagram |
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Pituitary | |
The Specific Disease | Pituitary gonadotrope tumor | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.034778653; Fold-change: -0.350134855; Z-score: -0.402544516 | |
Disease-specific Antigen Abundances |
![]() |
Click to View the Clearer Original Diagram |
The Studied Tissue | Pituitary | |
The Specific Disease | Pituitary cancer | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.503154952; Fold-change: -0.152171664; Z-score: -0.177703252 | |
Disease-specific Antigen Abundances |
![]() |
Click to View the Clearer Original Diagram |
ICD Disease Classification 03
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Whole blood | |
The Specific Disease | Thrombocytopenia | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.835883173; Fold-change: 0.165221165; Z-score: 0.169754317 | |
Disease-specific Antigen Abundances |
![]() |
Click to View the Clearer Original Diagram |
ICD Disease Classification 04
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Whole blood | |
The Specific Disease | Lupus erythematosus | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.120300281; Fold-change: -0.001477762; Z-score: -0.002619868 | |
Disease-specific Antigen Abundances |
![]() |
Click to View the Clearer Original Diagram |
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Peripheral monocyte | |
The Specific Disease | Autoimmune uveitis | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.255573333; Fold-change: -0.662835423; Z-score: -1.815307749 | |
Disease-specific Antigen Abundances |
![]() |
Click to View the Clearer Original Diagram |
ICD Disease Classification 05
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Whole blood | |
The Specific Disease | Familial hypercholesterolemia | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 7.93E-09; Fold-change: 1.183293454; Z-score: 1.857285532 | |
Disease-specific Antigen Abundances |
![]() |
Click to View the Clearer Original Diagram |
ICD Disease Classification 06
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Superior temporal cortex | |
The Specific Disease | Schizophrenia | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.459768882; Fold-change: 0.091860777; Z-score: 0.29615478 | |
Disease-specific Antigen Abundances |
![]() |
Click to View the Clearer Original Diagram |
ICD Disease Classification 08
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Spinal cord | |
The Specific Disease | Multiple sclerosis | |
The Expression Level of Disease Section Compare with the Adjacent Tissue | p-value: 0.162333481; Fold-change: 0.379395518; Z-score: 0.706220175 | |
Disease-specific Antigen Abundances |
![]() |
Click to View the Clearer Original Diagram |
The Studied Tissue | Plasmacytoid dendritic cells | |
The Specific Disease | Multiple sclerosis | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.464159222; Fold-change: -0.274144648; Z-score: -0.533247107 | |
Disease-specific Antigen Abundances |
![]() |
Click to View the Clearer Original Diagram |
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Peritumoral cortex | |
The Specific Disease | Epilepsy | |
The Expression Level of Disease Section Compare with the Other Disease Section | p-value: 0.623848954; Fold-change: -0.577580489; Z-score: -0.475914651 | |
Disease-specific Antigen Abundances |
![]() |
Click to View the Clearer Original Diagram |
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Whole blood | |
The Specific Disease | Cardioembolic Stroke | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.175402747; Fold-change: -0.109434792; Z-score: -0.638074485 | |
Disease-specific Antigen Abundances |
![]() |
Click to View the Clearer Original Diagram |
The Studied Tissue | Peripheral blood | |
The Specific Disease | Ischemic stroke | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.529168941; Fold-change: 0.222686112; Z-score: 0.687578636 | |
Disease-specific Antigen Abundances |
![]() |
Click to View the Clearer Original Diagram |
ICD Disease Classification 1
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | White matter | |
The Specific Disease | HIV | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.236473821; Fold-change: 0.036301049; Z-score: 0.149876341 | |
Disease-specific Antigen Abundances |
![]() |
Click to View the Clearer Original Diagram |
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Whole blood | |
The Specific Disease | Influenza | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.012216381; Fold-change: -0.36504202; Z-score: -1.901374358 | |
Disease-specific Antigen Abundances |
![]() |
Click to View the Clearer Original Diagram |
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Whole blood | |
The Specific Disease | Chronic hepatitis C | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.151115863; Fold-change: 0.219143246; Z-score: 0.510462102 | |
Disease-specific Antigen Abundances |
![]() |
Click to View the Clearer Original Diagram |
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Whole blood | |
The Specific Disease | Sepsis | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 1.29E-25; Fold-change: 0.825109155; Z-score: 1.85811299 | |
Disease-specific Antigen Abundances |
![]() |
Click to View the Clearer Original Diagram |
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Whole blood | |
The Specific Disease | Septic shock | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 7.29E-52; Fold-change: 0.825202223; Z-score: 1.847709454 | |
Disease-specific Antigen Abundances |
![]() |
Click to View the Clearer Original Diagram |
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Peripheral blood | |
The Specific Disease | Pediatric respiratory syncytial virus infection | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.105421222; Fold-change: -0.162646467; Z-score: -0.552483592 | |
Disease-specific Antigen Abundances |
![]() |
Click to View the Clearer Original Diagram |
ICD Disease Classification 11
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Peripheral blood | |
The Specific Disease | Essential hypertension | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.44422791; Fold-change: 0.018791373; Z-score: 0.075099156 | |
Disease-specific Antigen Abundances |
![]() |
Click to View the Clearer Original Diagram |
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Peripheral blood | |
The Specific Disease | Myocardial infarction | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.142639942; Fold-change: 0.135954377; Z-score: 0.21290877 | |
Disease-specific Antigen Abundances |
![]() |
Click to View the Clearer Original Diagram |
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Peripheral blood | |
The Specific Disease | Coronary artery disease | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.212366861; Fold-change: -0.141142296; Z-score: -0.565882662 | |
Disease-specific Antigen Abundances |
![]() |
Click to View the Clearer Original Diagram |
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Calcified aortic valve | |
The Specific Disease | Aortic stenosis | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.022922198; Fold-change: 0.812065241; Z-score: 1.766511187 | |
Disease-specific Antigen Abundances |
![]() |
Click to View the Clearer Original Diagram |
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Peripheral blood | |
The Specific Disease | Arteriosclerosis | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.734068267; Fold-change: 0.073710847; Z-score: 0.438842988 | |
Disease-specific Antigen Abundances |
![]() |
Click to View the Clearer Original Diagram |
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Intracranial artery | |
The Specific Disease | Aneurysm | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.670947823; Fold-change: -0.123526429; Z-score: -0.220847161 | |
Disease-specific Antigen Abundances |
![]() |
Click to View the Clearer Original Diagram |
ICD Disease Classification 12
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Peripheral blood | |
The Specific Disease | Immunodeficiency | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.001026367; Fold-change: -0.320853912; Z-score: -2.261234132 | |
Disease-specific Antigen Abundances |
![]() |
Click to View the Clearer Original Diagram |
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Hyperplastic tonsil | |
The Specific Disease | Apnea | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.045123101; Fold-change: -0.354402027; Z-score: -0.674340211 | |
Disease-specific Antigen Abundances |
![]() |
Click to View the Clearer Original Diagram |
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Peripheral blood | |
The Specific Disease | Olive pollen allergy | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.852065983; Fold-change: 0.210235515; Z-score: 0.609564723 | |
Disease-specific Antigen Abundances |
![]() |
Click to View the Clearer Original Diagram |
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Sinus mucosa | |
The Specific Disease | Chronic rhinosinusitis | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.283865678; Fold-change: 0.665310447; Z-score: 0.750746779 | |
Disease-specific Antigen Abundances |
![]() |
Click to View the Clearer Original Diagram |
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Lung | |
The Specific Disease | Chronic obstructive pulmonary disease | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.545350686; Fold-change: 0.043390834; Z-score: 0.07468145 | |
Disease-specific Antigen Abundances |
![]() |
Click to View the Clearer Original Diagram |
The Studied Tissue | Small airway epithelium | |
The Specific Disease | Chronic obstructive pulmonary disease | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.884519631; Fold-change: -0.056527811; Z-score: -0.075807109 | |
Disease-specific Antigen Abundances |
![]() |
Click to View the Clearer Original Diagram |
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Nasal and bronchial airway | |
The Specific Disease | Asthma | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 4.01E-08; Fold-change: 0.504939086; Z-score: 0.638427511 | |
Disease-specific Antigen Abundances |
![]() |
Click to View the Clearer Original Diagram |
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Nasal Epithelium | |
The Specific Disease | Human rhinovirus infection | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.079979008; Fold-change: -0.027250932; Z-score: -0.071050027 | |
Disease-specific Antigen Abundances |
![]() |
Click to View the Clearer Original Diagram |
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Lung | |
The Specific Disease | Idiopathic pulmonary fibrosis | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.276094328; Fold-change: 0.199522136; Z-score: 0.361921793 | |
Disease-specific Antigen Abundances |
![]() |
Click to View the Clearer Original Diagram |
ICD Disease Classification 13
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Gingival | |
The Specific Disease | Periodontal disease | |
The Expression Level of Disease Section Compare with the Adjacent Tissue | p-value: 0.427245525; Fold-change: -0.049511379; Z-score: -0.145515 | |
Disease-specific Antigen Abundances |
![]() |
Click to View the Clearer Original Diagram |
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Gastric antrum | |
The Specific Disease | Eosinophilic gastritis | |
The Expression Level of Disease Section Compare with the Adjacent Tissue | p-value: 0.10803778; Fold-change: 0.665086977; Z-score: 1.457583115 | |
Disease-specific Antigen Abundances |
![]() |
Click to View the Clearer Original Diagram |
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Liver | |
The Specific Disease | Liver failure | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 7.83E-06; Fold-change: 1.224347725; Z-score: 2.90896392 | |
Disease-specific Antigen Abundances |
![]() |
Click to View the Clearer Original Diagram |
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Colon mucosal | |
The Specific Disease | Ulcerative colitis | |
The Expression Level of Disease Section Compare with the Adjacent Tissue | p-value: 0.00539919; Fold-change: 0.443078129; Z-score: 1.036909859 | |
Disease-specific Antigen Abundances |
![]() |
Click to View the Clearer Original Diagram |
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Rectal colon | |
The Specific Disease | Irritable bowel syndrome | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.03968223; Fold-change: 0.083225862; Z-score: 0.273783035 | |
Disease-specific Antigen Abundances |
![]() |
Click to View the Clearer Original Diagram |
ICD Disease Classification 14
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Skin | |
The Specific Disease | Atopic dermatitis | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.007731925; Fold-change: -0.271588111; Z-score: -0.62794744 | |
Disease-specific Antigen Abundances |
![]() |
Click to View the Clearer Original Diagram |
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Skin | |
The Specific Disease | Psoriasis | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.735170264; Fold-change: 0.018144226; Z-score: 0.049231758 | |
The Expression Level of Disease Section Compare with the Adjacent Tissue | p-value: 0.091576051; Fold-change: 0.049895545; Z-score: 0.109596024 | |
Disease-specific Antigen Abundances |
![]() |
Click to View the Clearer Original Diagram |
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Skin | |
The Specific Disease | Vitiligo | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.914520836; Fold-change: -0.114383779; Z-score: -0.358215907 | |
Disease-specific Antigen Abundances |
![]() |
Click to View the Clearer Original Diagram |
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Skin from scalp | |
The Specific Disease | Alopecia | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.558624479; Fold-change: -0.011742606; Z-score: -0.029455772 | |
Disease-specific Antigen Abundances |
![]() |
Click to View the Clearer Original Diagram |
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Skin | |
The Specific Disease | Sensitive skin | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.521245984; Fold-change: -0.016613123; Z-score: -0.065675605 | |
Disease-specific Antigen Abundances |
![]() |
Click to View the Clearer Original Diagram |
ICD Disease Classification 15
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Synovial | |
The Specific Disease | Osteoarthritis | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.262277006; Fold-change: 0.891065455; Z-score: 0.564659373 | |
Disease-specific Antigen Abundances |
![]() |
Click to View the Clearer Original Diagram |
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Peripheral blood | |
The Specific Disease | Arthropathy | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.400342348; Fold-change: -0.005200648; Z-score: -0.022542858 | |
Disease-specific Antigen Abundances |
![]() |
Click to View the Clearer Original Diagram |
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Peripheral blood | |
The Specific Disease | Arthritis | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.120173529; Fold-change: 0.031496986; Z-score: 0.077076013 | |
Disease-specific Antigen Abundances |
![]() |
Click to View the Clearer Original Diagram |
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Synovial | |
The Specific Disease | Rheumatoid arthritis | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 2.74E-06; Fold-change: 2.482825011; Z-score: 5.016221727 | |
Disease-specific Antigen Abundances |
![]() |
Click to View the Clearer Original Diagram |
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Pheripheral blood | |
The Specific Disease | Ankylosing spondylitis | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.662683788; Fold-change: -0.029415511; Z-score: -0.059428906 | |
Disease-specific Antigen Abundances |
![]() |
Click to View the Clearer Original Diagram |
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Bone marrow | |
The Specific Disease | Osteoporosis | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.041187347; Fold-change: 0.85164953; Z-score: 2.13917697 | |
Disease-specific Antigen Abundances |
![]() |
Click to View the Clearer Original Diagram |
ICD Disease Classification 16
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Endometrium | |
The Specific Disease | Endometriosis | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.767964237; Fold-change: 0.790541341; Z-score: 0.5615832 | |
Disease-specific Antigen Abundances |
![]() |
Click to View the Clearer Original Diagram |
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Bladder | |
The Specific Disease | Interstitial cystitis | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.081696629; Fold-change: 0.373323596; Z-score: 1.424130785 | |
Disease-specific Antigen Abundances |
![]() |
Click to View the Clearer Original Diagram |
ICD Disease Classification 19
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Myometrium | |
The Specific Disease | Preterm birth | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.471122886; Fold-change: -0.090129656; Z-score: -0.140434105 | |
Disease-specific Antigen Abundances |
![]() |
Click to View the Clearer Original Diagram |
ICD Disease Classification 2
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Bone marrow | |
The Specific Disease | Acute myelocytic leukemia | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 2.26E-42; Fold-change: 1.222597562; Z-score: 1.791211521 | |
Disease-specific Antigen Abundances |
![]() |
Click to View the Clearer Original Diagram |
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Bone marrow | |
The Specific Disease | Myeloma | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 1.91E-05; Fold-change: 0.62607991; Z-score: 2.611722407 | |
Disease-specific Antigen Abundances |
![]() |
Click to View the Clearer Original Diagram |
The Studied Tissue | Peripheral blood | |
The Specific Disease | Myeloma | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.389740138; Fold-change: 0.301789427; Z-score: 0.461411362 | |
Disease-specific Antigen Abundances |
![]() |
Click to View the Clearer Original Diagram |
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Oral | |
The Specific Disease | Oral cancer | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.000101317; Fold-change: 0.692835016; Z-score: 0.961203063 | |
The Expression Level of Disease Section Compare with the Adjacent Tissue | p-value: 0.985037228; Fold-change: -0.392285419; Z-score: -0.370997907 | |
Disease-specific Antigen Abundances |
![]() |
Click to View the Clearer Original Diagram |
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Esophagus | |
The Specific Disease | Esophagal cancer | |
The Expression Level of Disease Section Compare with the Adjacent Tissue | p-value: 4.45E-07; Fold-change: -1.167367548; Z-score: -5.172729035 | |
Disease-specific Antigen Abundances |
![]() |
Click to View the Clearer Original Diagram |
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Rectal colon | |
The Specific Disease | Rectal cancer | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 1.82E-05; Fold-change: 1.01458646; Z-score: 3.980523965 | |
The Expression Level of Disease Section Compare with the Adjacent Tissue | p-value: 2.31E-07; Fold-change: 1.125988557; Z-score: 5.492849673 | |
Disease-specific Antigen Abundances |
![]() |
Click to View the Clearer Original Diagram |
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Skin | |
The Specific Disease | Skin cancer | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 4.97E-05; Fold-change: -0.310631196; Z-score: -0.578986296 | |
The Expression Level of Disease Section Compare with the Adjacent Tissue | p-value: 0.160815899; Fold-change: -0.1301539; Z-score: -0.248752585 | |
Disease-specific Antigen Abundances |
![]() |
Click to View the Clearer Original Diagram |
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Kidney | |
The Specific Disease | Renal cancer | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 1.84E-06; Fold-change: 1.004254391; Z-score: 2.239620512 | |
The Expression Level of Disease Section Compare with the Adjacent Tissue | p-value: 1.33E-24; Fold-change: 0.723698018; Z-score: 1.840971406 | |
Disease-specific Antigen Abundances |
![]() |
Click to View the Clearer Original Diagram |
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Urothelium | |
The Specific Disease | Ureter cancer | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.763974635; Fold-change: 0.076462192; Z-score: 0.272857029 | |
Disease-specific Antigen Abundances |
![]() |
Click to View the Clearer Original Diagram |
ICD Disease Classification 20
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Adipose | |
The Specific Disease | Simpson golabi behmel syndrome | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.555278433; Fold-change: 0.05212096; Z-score: 0.061122914 | |
Disease-specific Antigen Abundances |
![]() |
Click to View the Clearer Original Diagram |
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Perituberal | |
The Specific Disease | Tuberous sclerosis complex | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.004678815; Fold-change: 2.093376063; Z-score: 12.02643182 | |
Disease-specific Antigen Abundances |
![]() |
Click to View the Clearer Original Diagram |
ICD Disease Classification 3
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Bone marrow | |
The Specific Disease | Anemia | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.106999746; Fold-change: -0.396014917; Z-score: -1.082696851 | |
Disease-specific Antigen Abundances |
![]() |
Click to View the Clearer Original Diagram |
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Peripheral blood | |
The Specific Disease | Sickle cell disease | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.119911206; Fold-change: -0.187807461; Z-score: -0.805696576 | |
Disease-specific Antigen Abundances |
![]() |
Click to View the Clearer Original Diagram |
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Whole blood | |
The Specific Disease | Thrombocythemia | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 9.08E-10; Fold-change: -0.390722021; Z-score: -2.128092618 | |
Disease-specific Antigen Abundances |
![]() |
Click to View the Clearer Original Diagram |
ICD Disease Classification 4
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Whole blood | |
The Specific Disease | Scleroderma | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.001123002; Fold-change: -0.216547375; Z-score: -1.373891667 | |
Disease-specific Antigen Abundances |
![]() |
Click to View the Clearer Original Diagram |
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Salivary gland | |
The Specific Disease | Sjogren syndrome | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.200171655; Fold-change: -0.713770883; Z-score: -2.851038023 | |
The Expression Level of Disease Section Compare with the Adjacent Tissue | p-value: 0.105316764; Fold-change: 0.048513075; Z-score: 0.149659345 | |
Disease-specific Antigen Abundances |
![]() |
Click to View the Clearer Original Diagram |
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Peripheral blood | |
The Specific Disease | Behcet disease | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.98831863; Fold-change: 0.05081863; Z-score: 0.147435468 | |
Disease-specific Antigen Abundances |
![]() |
Click to View the Clearer Original Diagram |
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Whole blood | |
The Specific Disease | Autosomal dominant monocytopenia | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.008935631; Fold-change: 1.097104779; Z-score: 1.787688925 | |
Disease-specific Antigen Abundances |
![]() |
Click to View the Clearer Original Diagram |
ICD Disease Classification 5
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Liver | |
The Specific Disease | Type 2 diabetes | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.190496519; Fold-change: 0.141192524; Z-score: 1.246226893 | |
Disease-specific Antigen Abundances |
![]() |
Click to View the Clearer Original Diagram |
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Vastus lateralis muscle | |
The Specific Disease | Polycystic ovary syndrome | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.632309797; Fold-change: -0.019416541; Z-score: -0.174753211 | |
Disease-specific Antigen Abundances |
![]() |
Click to View the Clearer Original Diagram |
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Subcutaneous Adipose | |
The Specific Disease | Obesity | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.151057118; Fold-change: 0.149699576; Z-score: 0.509164424 | |
Disease-specific Antigen Abundances |
![]() |
Click to View the Clearer Original Diagram |
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Biceps muscle | |
The Specific Disease | Pompe disease | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.749487401; Fold-change: 0.365114515; Z-score: 0.63085407 | |
Disease-specific Antigen Abundances |
![]() |
Click to View the Clearer Original Diagram |
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Whole blood | |
The Specific Disease | Batten disease | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.425793632; Fold-change: -0.066932133; Z-score: -0.307638055 | |
Disease-specific Antigen Abundances |
![]() |
Click to View the Clearer Original Diagram |
ICD Disease Classification 6
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Whole blood | |
The Specific Disease | Autism | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.813109915; Fold-change: 0.112206326; Z-score: 0.291003732 | |
Disease-specific Antigen Abundances |
![]() |
Click to View the Clearer Original Diagram |
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Whole blood | |
The Specific Disease | Anxiety disorder | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.579038317; Fold-change: -0.088160111; Z-score: -0.3644152 | |
Disease-specific Antigen Abundances |
![]() |
Click to View the Clearer Original Diagram |
ICD Disease Classification 8
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Substantia nigra | |
The Specific Disease | Parkinson disease | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.796657365; Fold-change: 0.358281668; Z-score: 0.418417341 | |
Disease-specific Antigen Abundances |
![]() |
Click to View the Clearer Original Diagram |
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Whole blood | |
The Specific Disease | Huntington disease | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.228412441; Fold-change: 0.129339916; Z-score: 0.27141611 | |
Disease-specific Antigen Abundances |
![]() |
Click to View the Clearer Original Diagram |
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Entorhinal cortex | |
The Specific Disease | Alzheimer disease | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 1.44E-07; Fold-change: 0.665261542; Z-score: 0.826538898 | |
Disease-specific Antigen Abundances |
![]() |
Click to View the Clearer Original Diagram |
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Whole blood | |
The Specific Disease | Seizure | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.886114861; Fold-change: -0.05186837; Z-score: -0.123089874 | |
Disease-specific Antigen Abundances |
![]() |
Click to View the Clearer Original Diagram |
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Skin | |
The Specific Disease | Lateral sclerosis | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.712094131; Fold-change: 0.169375831; Z-score: 0.389514006 | |
Disease-specific Antigen Abundances |
![]() |
Click to View the Clearer Original Diagram |
The Studied Tissue | Cervical spinal cord | |
The Specific Disease | Lateral sclerosis | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.269313463; Fold-change: 0.067135832; Z-score: 0.404106952 | |
Disease-specific Antigen Abundances |
![]() |
Click to View the Clearer Original Diagram |
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Muscle | |
The Specific Disease | Muscular atrophy | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 2.26E-10; Fold-change: 1.753248569; Z-score: 6.572749661 | |
Disease-specific Antigen Abundances |
![]() |
Click to View the Clearer Original Diagram |
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Muscle | |
The Specific Disease | Myopathy | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.001271708; Fold-change: 1.12834868; Z-score: 1.893958801 | |
Disease-specific Antigen Abundances |
![]() |
Click to View the Clearer Original Diagram |
References
If you find any error in data or bug in web service, please kindly report it to Dr. Shen et al.