Antigen Information
General Information of This Antigen (ID: TAR0GORST)
| Antigen Name | Cytotoxic T-lymphocyte protein 4 (CTLA4) |
|||||
|---|---|---|---|---|---|---|
| Gene Name | CTLA4 |
|||||
| Gene ID | ||||||
| Synonym | CD152; Cytotoxic T-lymphocyte-associated antigen 4;CD152 |
|||||
| Sequence |
MACLGFQRHKAQLNLATRTWPCTLLFFLLFIPVFCKAMHVAQPAVVLASSRGIASFVCEY
ASPGKATEVRVTVLRQADSQVTEVCAATYMMGNELTFLDDSICTGTSSGNQVNLTIQGLR AMDTGLYICKVELMYPPPYYLGIGNGTQIYVIDPEPCPDSDFLLWILAAVSSGLFFYSFL LTAVSLSKMLKKRSPLTTGVYVKMPPTEPECEKQFQPYFIPIN Click to Show/Hide
|
|||||
| Function |
Inhibitory receptor acting as a major negative regulator of T-cell responses. The affinity of CTLA4 for its natural B7 family ligands, CD80 and CD86, is considerably stronger than the affinity of their cognate stimulatory coreceptor CD28.
Click to Show/Hide
|
|||||
| Uniprot Entry | ||||||
| HGNC ID | ||||||
| KEGG ID | ||||||
Each Antibody-drug Conjugate and Its Component Related to This Antigen
Full List of The ADC Related to This Antigen
| The Numbers of ADCs, Their Three Components, Payload Targets, and Corresponding Diseases for This Antigens | ||||
|---|---|---|---|---|
Anti-CTLA4 mAb clone 9D9
| ADC Name | Payload | Target | Linker | ADC Info |
|---|---|---|---|---|
|
CTLA4-IR700
[1]
|
IRDye 700DX |
Undisclosed |
Undisclosed |
Ipilimumab
| ADC Name | Payload | Target | Linker | ADC Info |
|---|---|---|---|---|
|
Ipilimumab-Compound 9
[2]
|
Mertansine DM1 |
Microtubule (MT) |
Ipilimumab-Compound 9 linker |
|
|
Ipilimumab-Compound 17
[2]
|
Mertansine DM4 |
Microtubule (MT) |
Ipilimumab-Compound 17 linker |
|
|
Ipilimumab-Compound 25
[2]
|
Monomethyl auristatin E |
Microtubule (MT) |
Ipilimumab-Compound 25 linker |
|
|
Ipilimumab-Compound 31
[2]
|
Auristatin 0101 |
Microtubule (MT) |
Ipilimumab-Compound 31 linker |
|
|
Ipilimumab-Compound 36
[2]
|
Monomethyl auristatin E |
Microtubule (MT) |
Ipilimumab-Compound 36 linker |
|
|
Ipilimumab-Compound 43
[2]
|
PBD dimer |
Human Deoxyribonucleic acid (hDNA) |
Ipilimumab-Compound 43 linker |
|
|
Ipilimumab-Compound 49
[2]
|
PBD dimer |
Human Deoxyribonucleic acid (hDNA) |
Ipilimumab-Compound 49 linker |
|
|
Ipilimumab-Compound 55
[2]
|
Mertansine DM1 |
Microtubule (MT) |
Ipilimumab-Compound 55 linker |
|
|
Ipilimumab-Compound 59
[2]
|
Mertansine DM4 |
Microtubule (MT) |
Ipilimumab-Compound 59 linker |
|
|
Ipilimumab-Compound 64
[2]
|
Monomethyl auristatin E |
Microtubule (MT) |
Ipilimumab-Compound 64 linker |
|
|
Ipilimumab-Compound 69
[2]
|
Monomethyl auristatin E |
Microtubule (MT) |
Ipilimumab-Compound 69 linker |
|
|
Ipilimumab-Compound 74
[2]
|
PBD dimer |
Human Deoxyribonucleic acid (hDNA) |
Ipilimumab-Compound 74 linker |
|
|
Ipilimumab-Compound 75
[2]
|
Monomethyl auristatin E |
Microtubule (MT) |
Ipilimumab-Compound 75 linker |
|
|
Ipilimumab-Compound 76
[2]
|
Monomethyl auristatin E |
Microtubule (MT) |
Ipilimumab-Compound 76 linker |
|
|
Ipilimumab-Compound 77
[2]
|
Mertansine DM1 |
Microtubule (MT) |
Ipilimumab-Compound 77 linker |
|
|
Ipilimumab-Compound 78
[2]
|
Auristatin 0101 |
Microtubule (MT) |
Ipilimumab-Compound 78 linker |
|
|
Ipilimumab-Compound 79
[2]
|
Auristatin 0101 |
Microtubule (MT) |
Ipilimumab-Compound 79 linker |
|
|
Ipilimumab-Compound 80
[2]
|
Mertansine DM4 |
Microtubule (MT) |
Ipilimumab-Compound 80 linker |
|
|
Ipi-DM1 38127423
[3]
|
Mertansine DM1 |
Microtubule (MT) |
Undisclosed |
|
|
Ipi-DM1 36909522
[4]
|
Mertansine DM1 |
Microtubule (MT) |
Undisclosed |
Undisclosed
| ADC Name | Payload | Target | Linker | ADC Info |
|---|---|---|---|---|
|
CTLA-4-targeted ETB
[5]
|
Undisclosed |
Undisclosed |
Undisclosed |
|
|
ADC CTLA4 Toxin
[6]
|
Undisclosed |
Undisclosed |
Undisclosed |
References
