Antigen Information
General Information of This Antigen
| Antigen ID | TAR0GORST |
|||||
|---|---|---|---|---|---|---|
| Antigen Name | Cytotoxic T-lymphocyte protein 4 (CTLA4) |
|||||
| Gene Name | CTLA4 |
|||||
| Gene ID | ||||||
| Synonym | CD152; Cytotoxic T-lymphocyte-associated antigen 4;CD_antigen=CD152 |
|||||
| Sequence |
MACLGFQRHKAQLNLATRTWPCTLLFFLLFIPVFCKAMHVAQPAVVLASSRGIASFVCEY
ASPGKATEVRVTVLRQADSQVTEVCAATYMMGNELTFLDDSICTGTSSGNQVNLTIQGLR AMDTGLYICKVELMYPPPYYLGIGNGTQIYVIDPEPCPDSDFLLWILAAVSSGLFFYSFL LTAVSLSKMLKKRSPLTTGVYVKMPPTEPECEKQFQPYFIPIN Click to Show/Hide
|
|||||
| Function |
Inhibitory receptor acting as a major negative regulator of T-cell responses. The affinity of CTLA4 for its natural B7 family ligands, CD80 and CD86, is considerably stronger than the affinity of their cognate stimulatory coreceptor CD28.
Click to Show/Hide
|
|||||
| Uniprot Entry | ||||||
| HGNC ID | ||||||
| KEGG ID | ||||||
Each Antibody-drug Conjuate AND It's Component Related to This Antigen
Full List of The ADC Related to This Antigen
Anti-CTLA4 mAb clone 9D9
| ADC Info | ADC Name | Payload | Target | Linker | Ref |
|---|---|---|---|---|---|
CTLA4-IR700 |
IRDye 700DX |
Undisclosed |
Undisclosed |
[1] |
Ipilimumab
| ADC Info | ADC Name | Payload | Target | Linker | Ref |
|---|---|---|---|---|---|
Ipilimumab-Compound 9 |
Mertansine DM1 |
Microtubule (MT) |
Ipilimumab-Compound 9 linker |
[2] | |
Ipilimumab-Compound 17 |
Mertansine DM4 |
Microtubule (MT) |
Ipilimumab-Compound 17 linker |
[2] | |
Ipilimumab-Compound 25 |
Monomethyl auristatin E |
Microtubule (MT) |
Ipilimumab-Compound 25 linker |
[2] | |
Ipilimumab-Compound 31 |
Auristatin 0101 |
Microtubule (MT) |
Ipilimumab-Compound 31 linker |
[2] | |
Ipilimumab-Compound 36 |
Monomethyl auristatin E |
Microtubule (MT) |
Ipilimumab-Compound 36 linker |
[2] | |
Ipilimumab-Compound 43 |
PBD dimer |
Human Deoxyribonucleic acid (hDNA) |
Ipilimumab-Compound 43 linker |
[2] | |
Ipilimumab-Compound 49 |
PBD dimer |
Human Deoxyribonucleic acid (hDNA) |
Ipilimumab-Compound 49 linker |
[2] | |
Ipilimumab-Compound 55 |
Mertansine DM1 |
Microtubule (MT) |
Ipilimumab-Compound 55 linker |
[2] | |
Ipilimumab-Compound 59 |
Mertansine DM4 |
Microtubule (MT) |
Ipilimumab-Compound 59 linker |
[2] | |
Ipilimumab-Compound 64 |
Monomethyl auristatin E |
Microtubule (MT) |
Ipilimumab-Compound 64 linker |
[2] | |
Ipilimumab-Compound 69 |
Monomethyl auristatin E |
Microtubule (MT) |
Ipilimumab-Compound 69 linker |
[2] | |
Ipilimumab-Compound 74 |
PBD dimer |
Human Deoxyribonucleic acid (hDNA) |
Ipilimumab-Compound 74 linker |
[2] | |
Ipilimumab-Compound 75 |
Monomethyl auristatin E |
Microtubule (MT) |
Ipilimumab-Compound 75 linker |
[2] | |
Ipilimumab-Compound 76 |
Monomethyl auristatin E |
Microtubule (MT) |
Ipilimumab-Compound 76 linker |
[2] | |
Ipilimumab-Compound 77 |
Mertansine DM1 |
Microtubule (MT) |
Ipilimumab-Compound 77 linker |
[2] | |
Ipilimumab-Compound 78 |
Auristatin 0101 |
Microtubule (MT) |
Ipilimumab-Compound 78 linker |
[2] | |
Ipilimumab-Compound 79 |
Auristatin 0101 |
Microtubule (MT) |
Ipilimumab-Compound 79 linker |
[2] | |
Ipilimumab-Compound 80 |
Mertansine DM4 |
Microtubule (MT) |
Ipilimumab-Compound 80 linker |
[2] | |
Ipi-DM1 38127423 |
Mertansine DM1 |
Microtubule (MT) |
Undisclosed |
[3] | |
Ipi-DM1 36909522 |
Mertansine DM1 |
Microtubule (MT) |
Undisclosed |
[4] |
Undisclosed
| ADC Info | ADC Name | Payload | Target | Linker | Ref |
|---|---|---|---|---|---|
CTLA-4-targeted ETB |
Undisclosed |
Undisclosed |
Undisclosed |
[5] | |
ADC CTLA4 Toxin |
Undisclosed |
Undisclosed |
Undisclosed |
[6] |
References
